KEGG   Marinobacter adhaerens: HP15_1522Help
Entry
HP15_1522         CDS       T01922                                 

Definition
dihydrolipoamide acetyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
mad  Marinobacter adhaerens
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mad00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HP15_1522
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HP15_1522
  Amino acid metabolism
   00310 Lysine degradation
    HP15_1522
Enzymes [BR:mad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     HP15_1522
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1603876..1605105
Genome map
AA seq 409 aa AA seqDB search
MSTEIKAPVFPESVAEGTVATWHKQPGEACSRDELIVDIETDKVVLEVVAPADGVIEEII
KNEGDTVESGEVVGKFKEGAKGESKPAEGKKEESKEEAPKEEAKSEASSGEAILSPAARK
LAEENNVDPNSIKGTGKDGRVTKEDVQNHVDSAKSSGGAAAPQPAAGMPEVNVSQGERPE
KRVPMTRLRASIAKRLVNAQQSAAMLTTFNEVNMGPIMEMRKQYQDSFVKRHGIKLGFMS
FFTKAATEALKRFPAVNASIDGNDMVYHGYQDIGVAVSTDRGLVVPVLRDSDAMGLADIE
KKIVEYGTKAKEGKLAIEDMTGGTFTITNGGIFGSLISTPILNPPQTAILGMHKIQERPM
AVNGKVEIQPMMYLALSYDHRMIDGKEAVQFLVAIKEMLEDPARILLDV
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgtcaactgagattaaagcccccgttttcccggagtcggtcgcggaaggtactgtcgcg
acctggcacaaacagccgggtgaagcctgctcccgtgacgagctgattgtcgatatcgag
accgacaaggttgttcttgaggttgttgcgcctgctgacggcgtgattgaagaaatcatc
aagaacgaaggcgataccgttgaaagtggtgaggtagtcggcaagttcaaggaaggcgcc
aagggcgaatccaagcctgccgagggtaagaaagaagaaagcaaggaagaggctccgaag
gaagaagccaagagtgaggcatcttccggcgaagccatcctgagcccggcggcccgaaag
ctggctgaggaaaataacgtcgatccgaacagcatcaagggtaccggtaaagatggccgc
gtaaccaaggaagacgttcagaaccacgtagacagcgccaagtcctccggcggtgctgcc
gcaccccagcctgcggctggtatgccggaagtcaacgtcagccagggcgaacgtcccgag
aagcgcgtaccgatgacccgcctgcgtgcgagcatcgccaagcgtctggttaatgcccag
cagagcgcagccatgctgaccacctttaacgaggtgaacatgggcccgatcatggagatg
cgcaagcagtaccaggacagctttgtgaagcgtcacggtatcaagcttggcttcatgtcg
ttctttaccaaggctgccaccgaagccctgaagcgcttcccggcggtgaacgcgtccatc
gatggtaacgacatggtgtatcacggttaccaggacatcggcgtggcggtttccaccgat
cgcggcctggtggttcctgttctgcgtgattccgacgccatgggtctggccgacatcgag
aagaagatcgtcgagtacggcaccaaggcgaaagaaggcaaactggccattgaagacatg
accggcggtaccttcacaattaccaacggcggtatcttcggttcgctgatttccacaccg
atcctgaacccgccgcagacagccatcctgggcatgcacaagatccaggagcgtccgatg
gccgtgaacggcaaggtggaaattcagccgatgatgtacctggcgctttcttacgaccac
agaatgattgatggtaaggaagcggtgcagttcctcgttgccatcaaggaaatgcttgaa
gacccggcacgtattctgctggacgtctga

DBGET integrated database retrieval system