KEGG   Marinobacter adhaerens: HP15_1524Help
Entry
HP15_1524         CDS       T01922                                 

Definition
(GenBank) succinyl-CoA synthetase, beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mad  Marinobacter adhaerens
Pathway
mad00020  Citrate cycle (TCA cycle)
mad00640  Propanoate metabolism
mad00660  C5-Branched dibasic acid metabolism
mad01100  Metabolic pathways
mad01110  Biosynthesis of secondary metabolites
mad01120  Microbial metabolism in diverse environments
mad01130  Biosynthesis of antibiotics
mad01200  Carbon metabolism
Module
mad_M00009  Citrate cycle (TCA cycle, Krebs cycle)
mad_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:mad00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    HP15_1524
   00640 Propanoate metabolism
    HP15_1524
   00660 C5-Branched dibasic acid metabolism
    HP15_1524
Enzymes [BR:mad01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     HP15_1524
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A ATP-grasp
Motif
Other DBs
NCBI-ProteinID: ADP97288
UniProt: E4PL80
Position
1606620..1607786
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFAEYGLPVSKGIACDTPKEAVDAAGEIGGDAWVVKAQVHAGGRGKAGGV
KLVKSKEEIREFAEKWLGQNLVTYQTDENGQPVSKILVESLTDIDQELYLGAVVDRGTRR
IVFMASTEGGVEIEKVAEETPEKILKAEIDPLVGAQPYQGRELAFKLGLEGKQIGQFTKI
FVGLAKLFEECDLALVEINPLVITPAGDLHCLDAKVGVDGNALYRQKKIHEMHDPSQEDS
REAEAAKWELNYVALEGNIGCMVNGAGLAMGTMDIIKLSGGQPANFLDVGGGATKERVSE
AFKIILSDSNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKVPVVVRLEGNNAEKGTQV
LAESGLNIIAATSLSNAAEQVVKAAGGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgaatatcagggcaaacagcttttcgctgaatatggcctgccagtatcc
aagggcattgcctgtgatactccgaaggaagctgtagacgcagctggtgaaatcggcggt
gatgcatgggttgtgaaagcccaggttcacgcaggtggccgtggtaaggctggtggtgta
aagctggtcaagagcaaagaagagatccgcgagtttgccgagaagtggctgggccagaac
ctggtaacctaccagacagatgaaaacggccagccggtgagcaagatcctggttgaatcc
ctcaccgacatcgaccaggagctttacctgggcgcggttgttgaccgtggcactcgccgc
atcgtgttcatggcttccaccgaaggtggtgttgagattgagaaggttgccgaagaaacg
cccgagaagatcctgaaagccgaaatcgacccgctggttggcgctcagccgtaccagggc
cgcgagctcgcgttcaagctgggcctggaaggcaagcagatcggtcagttcaccaagatc
ttcgttggtctggccaagctgttcgaagagtgcgatctggcactggtagaaatcaacccg
ctggttattaccccggctggtgatctgcactgcctggacgccaaagtcggcgtcgacggc
aacgcactgtaccgccagaagaagatccacgagatgcacgatccctcccaggaagattcc
cgggaagcggaagcggccaagtgggagctcaactacgtggccctggaaggcaacatcggc
tgcatggtcaacggtgccggcctggccatgggtaccatggacatcatcaagctgtccggc
ggccagcctgccaacttcctggacgttggcggcggtgcaaccaaggagcgtgtttccgag
gcattcaagatcatcctgtctgactccaatgtgaaggcggttctggtcaacatcttcggt
ggtatcgttcgctgcgacatgattgcagagggcatcatcggtgccgtgaaggaagtcggc
gtcaaggttcctgttgtggttcgccttgaaggcaacaacgcggagaagggtactcaggta
ctcgccgagagcggtctgaacatcattgccgctaccagtctgtcgaatgcggcagagcaa
gttgttaaagccgcagggggtaaataa

DBGET integrated database retrieval system