KEGG   Marinobacter adhaerens: HP15_1524Help
Entry
HP15_1524         CDS       T01922                                 

Definition
succinyl-CoA synthetase subunit beta
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mad  Marinobacter adhaerens
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mad01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:mad00020]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:mad00640]
Metabolism; Carbohydrate metabolism; C5-Branched dibasic acid metabolism [PATH:mad00660]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1606620..1607786
Genome map
AA seq 388 aa AA seqDB search
MNLHEYQGKQLFAEYGLPVSKGIACDTPKEAVDAAGEIGGDAWVVKAQVHAGGRGKAGGV
KLVKSKEEIREFAEKWLGQNLVTYQTDENGQPVSKILVESLTDIDQELYLGAVVDRGTRR
IVFMASTEGGVEIEKVAEETPEKILKAEIDPLVGAQPYQGRELAFKLGLEGKQIGQFTKI
FVGLAKLFEECDLALVEINPLVITPAGDLHCLDAKVGVDGNALYRQKKIHEMHDPSQEDS
REAEAAKWELNYVALEGNIGCMVNGAGLAMGTMDIIKLSGGQPANFLDVGGGATKERVSE
AFKIILSDSNVKAVLVNIFGGIVRCDMIAEGIIGAVKEVGVKVPVVVRLEGNNAEKGTQV
LAESGLNIIAATSLSNAAEQVVKAAGGK
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgaatttgcatgaatatcagggcaaacagcttttcgctgaatatggcctgccagtatcc
aagggcattgcctgtgatactccgaaggaagctgtagacgcagctggtgaaatcggcggt
gatgcatgggttgtgaaagcccaggttcacgcaggtggccgtggtaaggctggtggtgta
aagctggtcaagagcaaagaagagatccgcgagtttgccgagaagtggctgggccagaac
ctggtaacctaccagacagatgaaaacggccagccggtgagcaagatcctggttgaatcc
ctcaccgacatcgaccaggagctttacctgggcgcggttgttgaccgtggcactcgccgc
atcgtgttcatggcttccaccgaaggtggtgttgagattgagaaggttgccgaagaaacg
cccgagaagatcctgaaagccgaaatcgacccgctggttggcgctcagccgtaccagggc
cgcgagctcgcgttcaagctgggcctggaaggcaagcagatcggtcagttcaccaagatc
ttcgttggtctggccaagctgttcgaagagtgcgatctggcactggtagaaatcaacccg
ctggttattaccccggctggtgatctgcactgcctggacgccaaagtcggcgtcgacggc
aacgcactgtaccgccagaagaagatccacgagatgcacgatccctcccaggaagattcc
cgggaagcggaagcggccaagtgggagctcaactacgtggccctggaaggcaacatcggc
tgcatggtcaacggtgccggcctggccatgggtaccatggacatcatcaagctgtccggc
ggccagcctgccaacttcctggacgttggcggcggtgcaaccaaggagcgtgtttccgag
gcattcaagatcatcctgtctgactccaatgtgaaggcggttctggtcaacatcttcggt
ggtatcgttcgctgcgacatgattgcagagggcatcatcggtgccgtgaaggaagtcggc
gtcaaggttcctgttgtggttcgccttgaaggcaacaacgcggagaagggtactcaggta
ctcgccgagagcggtctgaacatcattgccgctaccagtctgtcgaatgcggcagagcaa
gttgttaaagccgcagggggtaaataa

DBGET integrated database retrieval system