KEGG   Marinobacter adhaerens: HP15_1709Help
Entry
HP15_1709         CDS       T01922                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
mad  Marinobacter adhaerens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:mad00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1803709..1805202)
Genome map
AA seq 497 aa AA seqDB search
MTSANDKDLFSARRAGVLLHPTCLPGSLGVLGAGARRFVDFLADSGITVWQTLPIGPTHQ
DLSPYQSLSAHAGNQDFIDLAELLQTGLLADAELAQPIAESRQQLLAIAAQRFYEGHATS
RKGLDLAGFEGFRARNDYWLDDFCLFCAIREVQESPGWLQWPEHLRDREPAALQAFVDQN
QARLARIRFEQFLFNHQWQALRDYARSRNVLLFGDIPIFVAQDSADVWANRQFFKLDARG
EPTVVAGVPPDYFSEEGQHWGNPLYNWQVMAEDGYQWWLQRLESQRHLFDLIRIDHFRGL
QAYWEIPAEAPQPRNGYWVPGPSDHFLQACFDRFPDLPLVAENLGIISDDVEELRHRFRL
PGMTVMQFGFDGSPNNPHLLHNHQPRDLVYTGTHDNDTTLGWYRSLDDRTRHYVNDYLAT
SGDGMPWPVIEAAFRSVCSLAVVPMQDFLGLGTEARFNTPGTITNNWTWKLDWNFPEKDL
SKIIAESVKRHGRLPPV
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgacttcagcgaacgacaaggatctgttcagtgcccgaagggccggtgtgctgcttcac
ccgacctgcctgcccggaagcctcggtgttctgggcgccggcgcccgccggttcgtcgat
tttctggccgacagtggcattaccgtctggcagacactgcctattggaccaacacaccag
gatctttcaccgtaccagtccctgagtgcccacgcgggcaaccaggattttattgacctc
gctgaactgctgcagactggactgctggccgacgctgaactggcccagcccatcgccgaa
tcccgccagcagctgctggctatcgccgcccaacggttttacgagggccatgccacaagc
cggaagggccttgatctggccggatttgaaggtttccgggcaagaaatgattactggctg
gatgatttctgtctgttctgcgcaatccgggaggttcaggagtcgccaggctggctccag
tggccagagcacttgagggatcgggagccggctgccttgcaggcctttgtcgaccaaaac
caggccagactggctcgcatcaggtttgagcagttcctgttcaaccaccagtggcaggca
ctcagggactatgcacgaagccgcaatgttttgctgtttggtgatatccccatttttgtc
gctcaagacagcgccgatgtctgggccaaccgacagttcttcaaactggacgcccggggc
gaacccactgtggttgccggtgtgccgccggactatttttccgaggagggccagcactgg
ggtaatccactctacaactggcaggttatggcggaagatggctaccagtggtggcttcaa
cggctcgaaagccagcgccatctgttcgatctgatccggatagaccattttcgggggctt
caggcctattgggagatcccggcagaggctcctcaaccacgaaacggctattgggttccc
ggcccctctgaccattttctacaggcctgcttcgaccgcttcccggatttacccctggta
gccgaaaacctcggcatcatcagcgacgatgtggaagaacttcgtcatcgcttccgcctg
ccagggatgacggtgatgcaatttggcttcgacggcagcccaaacaatccgcatctgctt
cacaaccaccagccccgggatcttgtctacaccggcacccacgataacgacacaacactg
gggtggtaccgcagcctggatgaccgtacccggcactatgtgaacgattatctggccacc
agtggtgatgggatgccatggccggtaattgaagcggcgttccgttcggtctgctcattg
gccgtggtgccgatgcaggatttcctcggtcttggaaccgaggcaaggttcaatacgccg
ggcaccattacaaataactggacatggaaactggactggaattttcccgagaaagacttg
tcgaaaataatcgctgaatcggtaaaacgacatgggcgccttcctccggtctga

DBGET integrated database retrieval system