KEGG   Marinobacter adhaerens: HP15_1712Help
Entry
HP15_1712         CDS       T01922                                 

Definition
glycogen branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
mad  Marinobacter adhaerens
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mad00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    HP15_1712
Enzymes [BR:mad01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     HP15_1712
Exosome [BR:mad04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HP15_1712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1808337..1810271
Genome map
AA seq 644 aa AA seqDB search
MKGRPKRLIWSGTARSMDSPTLSEFDLHLFAEGRHWHIYNVLGAHVCRNRGVEGVRFAVW
APHASAVSVAGDFNEWNAGIHPMSLHEGTGVWSCFIPGIGNGALYKFAITTDKGRQILKT
DPYGQAFELRPSTAAVVTERGHFGWGDGDWLARRGRWNWQDSPISIYEVHAASWRHHGSG
RWLTYRELADQLIPYVLELGFTHIELLPVTEHPLDESWGYQTTGYYAPTSRFGTPDDLRY
LVDQCHRHNIGVILDWVPGHFPTDEHALARFDGSALYEHEDPRKGRHQDWGTLIYNYGRH
EVRNFLIGSALFWLDAFHIDGLRVDAVASMLYLNYSRKEGEWEPNVHGGHENLEAIEFLR
ELNQVCQSRFPGTLVCAEESTSWPRVTRPPEIGGLGFNLKWNMGWMHDTLDYLAQDPVYR
QYHHDKLTFGLLYAFSENFLLPLSHDEVVHGKGSLINKMTGDEWQQRATLRVLFTYMFSY
PGAKLLFMGGEFGQRREWSESRELDWSLLAYPEHQGIKKLVQDLNGIYRREVSLHGACFK
PDGFEWIDCHDSPQSVISFLRTAKGETSVIVVNFTPMPRHHYRIGLPEGGNWREIFNSDS
EYYGGSNLGNPYPMPADAQPWMNREWSVELTLPPLGAIILRPAL
NT seq 1935 nt NT seq  +upstreamnt  +downstreamnt
atgaagggacgcccaaagcgcctcatctggtcaggaacagcacggtctatggacagtcca
acgctcagcgaattcgacctccacctttttgccgagggtcgacactggcacatttacaac
gtgctcggtgcccatgtctgcaggaaccgaggtgtggaaggtgtccggtttgcagtctgg
gcgccccacgccagcgcagtcagtgttgccggtgactttaacgaatggaacgcgggcatc
catcccatgtcgttgcatgaaggcacgggggtttggtcctgctttatcccgggcatcggt
aacggcgctctctataaattcgccatcacaacggacaaaggccggcagatcctgaaaacc
gatccctatggacaggctttcgagctcaggccctccaccgctgctgtagtcaccgagcgc
ggccactttggctggggcgatggcgactggctggcccggcggggtcgctggaactggcag
gattcgcccatctccatctacgaggttcatgccgcctcctggcgccaccacggttcgggt
cgatggctgacctatcgggaactggccgaccaactcattccctatgtgctcgaactgggc
ttcacccacattgaactgttgccggtcaccgaacaccccctggatgaatcctggggatac
cagaccaccggatactacgcgcccaccagtcggttcggcacgccggacgatcttcgttat
ctggtggaccaatgccaccggcacaacatcggcgtgattctggactgggtaccgggacat
ttcccgaccgatgaacacgcccttgcccgctttgatggcagcgcgctttacgaacatgaa
gatccccgcaaagggcgccatcaggactggggcacactcatctacaactatggccggcat
gaggtgcggaacttcctgatcggcagtgccttgttctggctggacgcctttcatatcgac
gggctcagggtggatgcggtggcttccatgctgtacctcaactactcccgcaaggaaggc
gaatgggagcccaacgtgcatggaggccatgaaaacctcgaagccattgagttcctgcgg
gaattgaaccaggtctgccaaagccgcttccccggaacgctggtctgtgcggaagaatcg
acctcctggccgcgtgtaacccggccaccggaaattggcggactcgggttcaacctgaaa
tggaacatgggctggatgcacgacaccctggactatctggcacaggatccggtgtatcgt
cagtatcatcacgacaagctgacctttgggctgctctatgccttctcggagaatttcctg
ctgccgctttcccacgacgaagtggttcatggcaaaggtagcctgatcaacaaaatgacc
ggcgacgaatggcaacagagagctaccttgagggtgctttttacctacatgttcagttac
ccgggcgccaaacttcttttcatgggcggtgagttcggccagcggcgggagtggagtgaa
tcccgggaactggactggtctctactggcctacccggagcatcagggtattaaaaagctg
gttcaggacctgaacggtatctaccggcgggaggtgtcgttacatggcgcctgcttcaag
ccggatggtttcgagtggattgactgccatgattccccccagtcagtgatcagtttcctg
cgcaccgccaagggcgaaacctcggtgattgtcgttaatttcacacccatgcccagacac
cactatcggatcggcctgcctgaaggtggcaactggcgggaaatttttaattccgattca
gagtattacggtgggagtaatctgggaaatccctaccccatgcctgcggatgcccagccc
tggatgaaccgtgagtggtccgtggaactaaccctgccaccactgggcgcgatcattctg
aggccggctttatga

DBGET integrated database retrieval system