KEGG   Marinobacter adhaerens: HP15_1768Help
Entry
HP15_1768         CDS       T01922                                 

Definition
delta 9 acyl-lipid fatty acid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
mad  Marinobacter adhaerens
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:mad00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    HP15_1768
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    HP15_1768
Enzymes [BR:mad01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     HP15_1768
Lipid biosynthesis proteins [BR:mad01004]
 Desaturase
  First
   HP15_1768
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1866345..1866881
Genome map
AA seq 178 aa AA seqDB search
MGWFTCDAGFATDERRIRDWLKFPELRLINRFDALVPALAAVGIYALGEALAAWAPGLGT
NGLQMLIWGFFISTVVLFHATVSINSLSHVWGKRRFETSDDSRNNFWLALLTLGEGWHNN
HHRWPQSVRQGFRWYEIDITWYGLWLMSKLGIIWELNPIPKHIQEETRELDKMRRSRQ
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atggggtggttcacctgtgacgccggctttgcgaccgacgaacgtcggattcgggactgg
ctgaaattcccggaactcaggctgattaaccggtttgacgctctggtaccggctctcgcc
gccgttggtatctacgcgctgggcgaagcattggccgcgtgggctccggggttggggacc
aacggtctgcagatgcttatctggggattcttcatatcgaccgtcgtgctgtttcacgcc
acggtatccatcaactctctgtcccacgtctggggcaagcgccgatttgaaacctcggac
gacagccggaacaacttctggctcgctctgcttaccctgggcgaaggatggcacaacaat
caccaccgctggccgcaatctgttcgccaggggttccggtggtatgaaattgacatcacc
tggtatgggctatggctgatgtcgaagcttggcatcatctgggagctcaacccgataccc
aagcacattcaggaagaaacacgcgaactggataaaatgaggaggagcaggcaatga

DBGET integrated database retrieval system