KEGG   Marinobacter adhaerens: HP15_1826Help
Entry
HP15_1826         CDS       T01922                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
mad  Marinobacter adhaerens
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mad00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HP15_1826
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HP15_1826
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HP15_1826
Enzymes [BR:mad01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HP15_1826
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1923155..1923967)
Genome map
AA seq 270 aa AA seqDB search
MSRIEGVLKALKGQGRKALIPYITAGDPHPDVTVDLMHTLVEAGADIIELGVPFSDPMAD
GPVIQLACERALVHGTSLRQVIAMVKEFRKSDDATPVVLMGYLNPMEAMGYERFADAAKD
AGVDGILTVDLPPEEADEVAPLFTQRNLDAIFLLSPTTTDDRIRAISEHSSGYVYYVSIK
GVTGSATINVEEVAAKVNHIHELTALPVGVGFGIRDAETAAAVGRVSDGVIVGSVLVDTI
ARNQADTDQLKRALTDLLHPMREALDSLAS
NT seq 813 nt NT seq  +upstreamnt  +downstreamnt
atgagccgaattgaaggggtcctcaaggccctgaaaggacaaggtcgtaaggcacttatt
ccctatattactgccggtgacccgcatcccgatgtcacggtagatctgatgcacacgctg
gttgaggcgggggcagatattatcgagctgggggtgccgttctctgaccccatggcagac
ggcccggtaatccagcttgcctgtgagcgggccctggtgcacggtacctcgctgaggcag
gtgattgccatggtcaaggagttccgcaagtcagacgacgcaactccggtggttttgatg
ggctacctgaacccgatggaagccatgggctacgagcgttttgcggatgcggccaaggat
gctggcgtagacggcattctgaccgttgacttgccaccggaagaggccgacgaggttgct
ccgctgttcacccagcgaaatctcgacgccatcttcctgctttcaccaaccacgaccgat
gaccggatccgggcaatcagtgagcactcctccggttatgtgtactatgtttctatcaag
ggtgtgacgggatcggccaccatcaacgtggaagaggtagctgccaaggtgaatcatatt
cacgaactgacagctctcccggtgggtgtcggtttcggtattcgtgatgcggaaactgcc
gcggcggtcggtcgggtatccgatggtgtaattgttggcagcgtcctggtcgatacaata
gccagaaatcaggcagataccgaccagctcaagcgggcattgacggatctgctccacccg
atgcgtgaagcactggacagtctcgcctcctga

DBGET integrated database retrieval system