KEGG   Marinobacter adhaerens: HP15_1827Help
Entry
HP15_1827         CDS       T01922                                 

Definition
(GenBank) tryptophan synthase, beta subunit
  KO
K01696  tryptophan synthase beta chain [EC:4.2.1.20]
Organism
mad  Marinobacter adhaerens
Pathway
mad00260  Glycine, serine and threonine metabolism
mad00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mad01100  Metabolic pathways
mad01110  Biosynthesis of secondary metabolites
mad01130  Biosynthesis of antibiotics
mad01230  Biosynthesis of amino acids
Module
mad_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mad00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HP15_1827
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HP15_1827
Enzymes [BR:mad01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     HP15_1827
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: ADP97591
UniProt: E4PPA4
Position
complement(1923987..1925207)
Genome map
AA seq 406 aa AA seqDB search
MSVKLTEEMLSALPDARGHFGAFGGRFVSETLMDSLMTLEKEYARLKKDPEFQARFDKEL
ADYVGRPTPLYFAERLSRETGGAQIWLKREDLCHTGAHKVNNTIGQALLASFLGKKRIIA
ETGAGQHGVATATVCARLGLECHVFMGAEDVQRQSLNVFRMKLLGATVHAVQGGTKTLKD
AMNDAMRDWVAHVDDTFYIIGTVAGPHPYPLLVRDFQSVIGRETRRQALEKTGKLPDALV
ACVGGGSNAIGMFYPFLSDESVQLYGVEAGGLGIDTGKHAAPLCAGRPGVLHGNRTYLME
DENGQIAGTHSVSAGLDYPGVGPEHSWLKDIGRANYVSVTDDEAMEGFRKLTRVEGIMPA
LETAHAVAYAIKLAATMDKDQTVVINVSGRGDKDINTVAKLEGIEI
NT seq 1221 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgtaaaactgactgaagaaatgctgagcgcactgccggacgcgcggggtcacttc
ggcgcctttggtgggcgatttgtttccgagactctgatggattccctgatgacgctcgag
aaagaatacgcccgcctgaagaaggatccggaattccaggcgcggttcgacaaggaactg
gcggactatgttggccggccaacccctctgtatttcgccgagcgtctcagccgtgaaacc
ggcggcgcccagatctggctcaagcgtgaagatctttgtcacaccggtgcccataaggtg
aacaacacgatcggccaggcgctgcttgccagtttcctcggtaaaaagcggatcattgcc
gaaaccggtgcgggtcagcacggtgttgccactgccactgtttgcgcgcgtctgggtctt
gaatgccatgtgttcatgggcgcggaggatgtccagcgacagtctctgaacgtgttccgg
atgaagcttctgggcgcgacggtacatgccgttcagggtggcaccaaaaccctaaaggat
gccatgaacgatgcgatgcgtgactgggtggctcacgtggacgacactttctatatcatt
ggtaccgttgcggggccgcatccatatccgctgctggtccgggatttccagtcggtaatc
ggtcgtgaaacccgtcgtcaggcgctggagaaaaccggcaaattgccggatgccctggtt
gcttgtgtgggtggtggttccaacgccattggcatgttctatccgttcctttctgacgaa
tcggtacagctttacggtgtcgaggctggcggcctgggcattgatactggcaaacacgcg
gcaccactctgtgccggtcgtcctggcgtgcttcacggtaaccgcacctacctgatggag
gacgaaaatggccagatcgcagggacgcattcggtgagtgccggcctggactatccaggg
gtgggtccagagcacagctggttgaaggacattggccgtgccaattatgtgtccgttacc
gatgacgaagcgatggaagggttccggaaattgacccgcgtcgagggcattatgcccgcg
ctggaaacggctcacgctgtcgcttatgccatcaaactggcggcgaccatggacaaagac
cagaccgttgtcattaacgtttccgggcgtggcgacaaggacattaacacggttgccaag
cttgaaggcatcgagatctga

DBGET integrated database retrieval system