KEGG   Marinobacter adhaerens: HP15_1887Help
Entry
HP15_1887         CDS       T01922                                 

Definition
aldose 1-epimerase family protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
mad  Marinobacter adhaerens
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mad00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HP15_1887
Enzymes [BR:mad01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     HP15_1887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1991724..1992524
Genome map
AA seq 266 aa AA seqDB search
MFIQGAHLASFKPQDESDWLWMSPAARYEPGRAIRGGIPVCWPWFGDPARNAPEVRKRIQ
TDQAHGFARTALWKLEDVRENAHEVEISLSLDANEDFSDVWIGHALALLTFSFSIRGCQL
ALTTTNLGNDPLAFTQALHTYLPTSDITRTRVLGLGNSQYIDTLDNWEYRNQEGPVYFDG
ETDRIYESGETLTIVTPRTGRKLSAVGSDSTVVWNPGPAKAAKLSDFPDTAWQSMLCVET
ANAASDYRVLNNGQSHTLGVFIGRKS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
gtgtttattcagggcgctcacctggcaagcttcaaacctcaggatgaatctgactggctc
tggatgagcccagcggcccggtacgaacccggtcgagccatccgcggcggcatccccgtg
tgctggccctggtttggcgatccggcccgcaacgcgccggaagtgcggaaacgcatccag
accgaccaagcccacgggtttgcccgtaccgcgctctggaaactggaagatgtccgggag
aacgcccacgaagtggaaatcagcctgtccctggatgccaatgaagatttcagtgatgtc
tggatcgggcatgcgctcgccctgctcaccttcagcttctccatccgcggatgccaactg
gctttgacgaccacgaacctggggaacgatccgctggcctttacccaggcgctccatact
tatttgccgaccagcgacataacccggactcgtgtgctgggtctcggaaacagccagtac
atcgacaccctggataactgggaataccgcaaccaggaaggccctgtgtatttcgacggc
gaaacggaccgcatctatgagagcggcgaaaccctgacgatcgtgacaccccgaactggc
cgcaagctctcggccgtaggaagtgactcaactgtggtctggaaccccggtccggccaag
gcggccaagctatcggattttcccgatacggcctggcagtccatgctgtgcgtcgaaacc
gccaatgcagccagcgattatcgggtgcttaataacgggcaaagccacacattaggcgta
ttcattggaaggaaatcatga

DBGET integrated database retrieval system