KEGG   Marinobacter adhaerens: HP15_1935Help
Entry
HP15_1935         CDS       T01922                                 

Gene name
galU
Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mad  Marinobacter adhaerens
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mad00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    HP15_1935 (galU)
   00052 Galactose metabolism
    HP15_1935 (galU)
   00500 Starch and sucrose metabolism
    HP15_1935 (galU)
   00520 Amino sugar and nucleotide sugar metabolism
    HP15_1935 (galU)
Enzymes [BR:mad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     HP15_1935 (galU)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2055078..2055914
Genome map
AA seq 278 aa AA seqDB search
MIKKCLFPVAGYGTRFLPATKAMPKEILPVVNKPLVQYGVEEAAEAGIHEFGFVTGRGKR
AIEDHFDISYELEQQIAGSGKEELLTSIRELIDHNSFAFTRQNEMKGLGHAILTGRNLVG
DNPFAVVLADDFCIGPDGEDGVLAQMVKLYNQFRCSIVAIEEVPADETHKYGVIAGESMK
DGLYRITDMVEKPAPEDAPSNLAIIGRYILTPDIFEIIEKTPAGKNGEVQITDALLEQAK
NGCVLAYQFKGRRFDCGSIDGFVEATNYVYENIYKKDK
NT seq 837 nt NT seq  +upstreamnt  +downstreamnt
atgatcaaaaaatgcctgtttcccgtcgccggctacggcacccgctttcttccggccacc
aaggcgatgcccaaggagatcctgccggtagtaaacaaacccctggttcagtacggcgtt
gaggaagccgccgaagcaggtattcacgaattcggcttcgtgaccggtcgcggcaagcgg
gccatcgaggatcatttcgacatcagctacgaactcgaacaacagattgccggctcgggt
aaggaagagctgctgacctccatccgcgagctgatcgaccacaacagttttgccttcacc
cggcagaatgagatgaagggcctcggccacgccatactgactggtcgcaacctggtgggt
gacaacccgtttgcggtcgtgctggcggatgacttctgcattggccccgacggtgaagat
ggcgtcctggcgcagatggtgaagctctacaaccagttccgctgctctattgtagccatc
gaagaagtgccggctgatgaaacccacaagtacggggtgatcgcaggtgaatccatgaaa
gatggcctctaccggatcacagacatggtagaaaagccggctccggaagatgcgcccagc
aacctcgccattatcggccgctatattctcacgccggatatcttcgaaattattgagaag
accccggcgggcaagaacggtgaagtccagatcaccgatgcccttctcgagcaggcgaaa
aatggttgcgtgctggcttatcagttcaaaggtcgccggttcgattgcggcagcattgat
ggctttgtggaagccaccaactacgtctacgagaatatctacaagaaagacaagtaa

DBGET integrated database retrieval system