KEGG   Marinobacter adhaerens: HP15_210Help
Entry
HP15_210          CDS       T01922                                 

Definition
phospholipase A(1)
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
mad  Marinobacter adhaerens
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mad00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    HP15_210
   00565 Ether lipid metabolism
    HP15_210
   00590 Arachidonic acid metabolism
    HP15_210
   00591 Linoleic acid metabolism
    HP15_210
   00592 alpha-Linolenic acid metabolism
    HP15_210
Enzymes [BR:mad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     HP15_210
    3.1.1.32  phospholipase A1
     HP15_210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(197198..198325)
Genome map
AA seq 375 aa AA seqDB search
MTSPHLLAPPTAITTLSLMLSVPVNVSAQTEEAPSIDSPEQCALIDDGIKRLACFDSLYK
PTESQAQASESAKEQAEKSAEQLAPNGKDLDAVAGSALEGDSDAGVMSALVDRYVAAEKA
VFSFSGSFVGHRPTYILPVSWVKDPNESPSSPRLGSIGYDYDLEREEAKYQISFKVPLLT
GILDDRTTLWFGYTQTSFWQVYNQDDSAPFRETNYEPEIFARYQTDWDIGPGRLNGVTLG
FNHQSNGQSEPRSRSWNRIMGSAAYSYDRWLFMVQPWYRIPENNDDDNVDIQRYLGYANY
HAVYKLTEDRTFSLRLMNNLRSDDNKTSVEFGYSFPMGDTVKGFFQYYNGYGESLIDYNH
RIQRFGIGIMLNDWL
NT seq 1128 nt NT seq  +upstreamnt  +downstreamnt
atgacatccccacacctgttggcgccgcccacggccatcactaccctctcgttgatgctg
tcggtgcctgtaaacgtgtcggcacagactgaggaagcgccctccattgattcacccgaa
cagtgcgccctgattgacgatggcatcaagcgactggcctgttttgacagcctctacaaa
cccacagagagccaggcccaggcatcggaaagcgccaaggaacaggccgagaagagcgcg
gagcaactggcgcccaatggtaaagatctcgatgccgttgccggcagtgccctggaaggc
gattccgacgcaggcgttatgtctgccttggtggaccgctatgtggccgccgagaaagcc
gtgttttccttctccggcagttttgtggggcaccggcccacctacatcctgccggtgagc
tgggtaaaagacccgaacgaatccccatcgagcccccggctcgggtctatcggttatgac
tacgacctggaacgggaagaagccaagtaccagatcagcttcaaggtgccactgctgacg
ggaattctggatgaccgcacaacactctggtttggctatacccagacctcgttctggcag
gtgtacaaccaggacgactccgcgcctttccgggaaaccaactacgagccggagatattc
gcccgataccagaccgactgggatatcggaccgggccgactcaatggcgtaaccctcgga
tttaatcaccagtccaacgggcagtcagaaccgaggtcccggagctggaatcgcatcatg
ggctcagccgcgtacagttatgatcgctggctctttatggtccagccctggtatcggatt
ccggagaacaatgacgatgataatgtggacatccagcgctacctggggtatgccaattac
catgcggtatacaagctgaccgaggatcggacgttttcgttgcggctgatgaataacctg
cggtcggatgataacaaaacgtcggtggagttcgggtacagtttcccaatgggggataca
gttaaggggttcttccagtactacaacggatatggggagagtctgatcgactataaccac
cggattcagcggttcggtatcgggattatgctgaacgactggctctga

DBGET integrated database retrieval system