KEGG   Marinobacter adhaerens: HP15_2155Help
Entry
HP15_2155         CDS       T01922                                 

Gene name
tpiA
Definition
(RefSeq) triosephosphate isomerase (EC:5.3.1.1)
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
mad  Marinobacter adhaerens
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mad00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HP15_2155 (tpiA)
   01230 Biosynthesis of amino acids
    HP15_2155 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HP15_2155 (tpiA)
   00051 Fructose and mannose metabolism
    HP15_2155 (tpiA)
   00562 Inositol phosphate metabolism
    HP15_2155 (tpiA)
Enzymes [BR:mad01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     HP15_2155 (tpiA)
Exosome [BR:mad04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   HP15_2155 (tpiA)
  Exosomal proteins of bladder cancer cells
   HP15_2155 (tpiA)
  Exosomal proteins of melanoma cells
   HP15_2155 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2260990..2261796)
Genome map
AA seq 268 aa AA seqDB search
MRKPILIGNWKMNGSLQANQALMVRVLPRLRMFRKSVDLVVCPPHPYLFQVRDLLGYTGI
MLGAQNASGFVSGAYTGEVSATMLQEMGCRYALVGHSERRLLFGEGNQEVAARYRSVLQS
GLTPVLCVGETLEDRESGRTGLIIEQQLQAVIDEVGLAAMANGIVAYEPVWAIGTGKTAT
PEQVSEVHQQIRQFLAKSAPESADDISEELRVIYGGSVKVANAYELFSLADVDGGLIGGA
SLHADEFGTIAGALAEASGILAGECETH
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaccgattctgattggaaactggaaaatgaatggcagcctccaggcaaaccag
gccctgatggtgcgcgtcttaccccgacttcggatgttccgtaagtctgttgatctggtg
gtatgcccgccgcatccgtacctgttccaggtgcgtgatctgcttggctataccggcatc
atgctgggcgcccagaatgcatccgggtttgtctctggtgcctacaccggcgaggtcagc
gccaccatgcttcaggaaatgggctgccggtatgcgctcgtgggtcactccgagcgccga
ctactgttcggcgagggcaaccaggaggtggcagcccgataccgctcggttttgcagtcc
ggccttacaccggtgctatgcgtcggtgagactctggaagacagggagtcgggccgtacc
ggtctgattatcgaacagcagctacaggcagtgattgacgaggtcggcctggcggccatg
gctaatggaatcgttgcctatgaaccggtttgggctatcggaacgggcaaaacagcaacg
ccggagcaggtttcggaggtgcatcaacagatccgtcagttcctcgccaaaagcgcgccc
gagtcagccgacgacatcagcgaggagctgcgggtgatatacgggggcagcgttaaagtt
gccaatgcctatgaactgttcagccttgccgacgttgatggcggcttgattggcggtgcc
tcactgcacgcggatgaattcggaacgatcgccggagccctggctgaggcttccggaatt
ctggccggcgaatgcgaaacccactga

DBGET integrated database retrieval system