KEGG   Marinobacter adhaerens: HP15_2188Help
Entry
HP15_2188         CDS       T01922                                 

Gene name
glcB2
Definition
(GenBank) malate synthase G
  KO
K01638  malate synthase [EC:2.3.3.9]
Organism
mad  Marinobacter adhaerens
Pathway
mad00620  Pyruvate metabolism
mad00630  Glyoxylate and dicarboxylate metabolism
mad01100  Metabolic pathways
mad01110  Biosynthesis of secondary metabolites
mad01120  Microbial metabolism in diverse environments
mad01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mad00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HP15_2188 (glcB2)
   00630 Glyoxylate and dicarboxylate metabolism
    HP15_2188 (glcB2)
Enzymes [BR:mad01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     HP15_2188 (glcB2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Malate_synthase PsiF_repeat
Motif
Other DBs
NCBI-ProteinID: ADP97952
UniProt: E4PF72
Position
complement(2303368..2305548)
Genome map
AA seq 726 aa AA seqDB search
MTERVQVGGIQVAKNLYDFVNNEAIPGTGIDADKFWAEFDKIVNELAPRNRELLAKRDAI
QEKMDSWNRDHKGQKLDMGEYKSFLKDIGYLVDEPSEFKISTSNVDPEVATMAGPQLVVP
IMNARFALNAANARWGSLYDALYGTDAISEEDGAEKGRGYNPVRGAKVIEWARNLLDSSA
PLASGSHKDAAKYVVVGGKLVVKLQNGESTGLKDEAGFVGYTGAADAPTGVLLVKNGMHF
EIQIDATHPIGKDDGAHVKDVLMESALTTIMDCEDSVAAVDADDKALAYRNWLGLMKGDL
QETFEKGGEQLTRKMNADRTYTAADGSELSLKGRSLMFIRNVGHLMTNPAILLKDGNEVP
EGLMDGLITSLIAIHDMKGNGKFQNSTKGSMYIVKPKMHGPEEVAFTNEFFGRVEDALSL
PRFSLKVGIMDEERRTTVNLKACIHAAKERAVFINTGFLDRTGDEIHTSMELGPFIRKGA
MKQATWINAYEQWNVDIGLETGFRGVAQIGKGMWAMPDLMAGMLEAKIGHPKAGANTAWV
PSPTAATLHATHYHQVSVADVQKQLESRTRAALDDILTVPVMDDPASLSAEDIQQELDNN
AQGILGYVVRWIDQGVGCSKVPDINDVGLMEDRATLRIASQLLANWLHHGICSEDQIMET
MKRMAAVVDKQNAGDSAYRPMAGNFDDSVAFQAALDLVLKGREQPNGYTEPLLHAYRLKA
KAKYGQ
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacgcgtacaagtcggcggcattcaggtcgcaaagaatctgtatgatttcgtg
aacaacgaagcgatcccgggcaccggaatcgatgccgataaattctgggcagaatttgac
aagatcgtgaacgagctggcgccacgcaaccgtgaattgctggccaagcgtgatgctatc
caggaaaaaatggacagctggaaccgggatcacaagggccagaagctcgacatgggcgaa
tacaagtctttcctgaaagacatcggttacctggttgacgagccttccgagttcaagatc
tccacctccaatgtcgacccggaagtggcaaccatggccggccctcagctggtggtgccg
atcatgaacgcccgttttgctctgaacgctgcgaacgcgcgttggggtagcctgtacgat
gcgctgtacggtaccgacgcgatttccgaggaagacggcgctgaaaaaggccgtggttac
aatccggttcgcggtgcaaaagttatcgagtgggcccgcaacctgctcgacagctcggca
ccgctggcctctggcagtcacaaagatgctgccaagtatgtggttgtaggtggcaaactg
gtcgtcaagctgcagaacggtgagtccaccggcctgaaagacgaagccggctttgttggc
tacaccggtgccgctgatgcgcccaccggcgtactgctggtcaagaacggcatgcacttc
gagatccagatcgatgccactcacccgattggcaaagacgacggtgcccacgtcaaagac
gtactgatggagtctgcactgacaaccatcatggactgcgaagactccgtggccgctgta
gacgccgacgacaaggcgctggcctatcgcaactggctgggcctgatgaagggcgacctg
caggaaaccttcgagaaaggtggcgagcagttgacccgcaagatgaacgcggatcgcacc
tacaccgcggcagacggcagcgagctgagcctgaaaggccgcagcctgatgtttatccgt
aacgtcggccacctgatgaccaacccggccatcctgctgaaagacggtaacgaagtgccg
gaaggcctgatggacggtctgatcacctcgctgatcgccattcacgacatgaagggcaat
ggcaagttccagaacagcaccaaaggctccatgtatatcgtgaagcctaagatgcacggg
ccggaagaggtggcattcaccaacgaatttttcggtcgtgtagaggatgcattgagcctg
ccgcgcttcagcctgaaggtcggcatcatggacgaggagcgtcgcaccacagttaacctg
aaagcctgtatccacgccgcgaaagagcgggctgtgtttattaacaccggtttcctggat
cgcaccggggacgagatccatacctccatggagctgggtccgtttatccgcaagggtgcg
atgaagcaggcgacctggatcaatgcctacgagcagtggaacgtggacatcggcctggaa
accggtttccgtggcgttgcccagattggtaagggcatgtgggccatgcctgacctgatg
gctggcatgctggaagcgaaaatcgggcatccgaaggccggtgcgaacactgcctgggtt
ccatctcccacggcggctacactgcacgccactcactaccatcaggtaagtgtggctgat
gtccagaagcagctggaaagccgcacccgcgccgcgctggacgatatcctgaccgtaccg
gtgatggatgatcccgcttctttgagcgccgaggacatccagcaggagctggacaacaac
gcccagggcatccttggttacgttgtgcgctggattgaccagggtgttggctgctccaag
gtgccggacatcaacgatgtcggcctgatggaagaccgtgcgactctgcgtatcgcctcc
cagttgctggccaactggctgcaccatggtatctgctctgaagatcagatcatggagacc
atgaagcgtatggcagcggtagtcgacaagcagaacgccggtgattcggcgtaccgcccg
atggccgggaacttcgatgacagtgtcgccttccaggcagcgctggatctggttctcaag
ggccgcgagcagcctaatggctacaccgagccgctactgcacgcttaccgtctgaaggcg
aaagccaaatacgggcagtaa

DBGET integrated database retrieval system