KEGG   Marinobacter adhaerens: HP15_2188Help
Entry
HP15_2188         CDS       T01922                                 

Gene name
glcB2
Definition
malate synthase G (EC:2.3.3.9)
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
mad  Marinobacter adhaerens
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:mad01200]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:mad00620]
Metabolism; Carbohydrate metabolism; Glyoxylate and dicarboxylate metabolism [PATH:mad00630]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2303368..2305548)
Genome map
AA seq 726 aa AA seqDB search
MTERVQVGGIQVAKNLYDFVNNEAIPGTGIDADKFWAEFDKIVNELAPRNRELLAKRDAI
QEKMDSWNRDHKGQKLDMGEYKSFLKDIGYLVDEPSEFKISTSNVDPEVATMAGPQLVVP
IMNARFALNAANARWGSLYDALYGTDAISEEDGAEKGRGYNPVRGAKVIEWARNLLDSSA
PLASGSHKDAAKYVVVGGKLVVKLQNGESTGLKDEAGFVGYTGAADAPTGVLLVKNGMHF
EIQIDATHPIGKDDGAHVKDVLMESALTTIMDCEDSVAAVDADDKALAYRNWLGLMKGDL
QETFEKGGEQLTRKMNADRTYTAADGSELSLKGRSLMFIRNVGHLMTNPAILLKDGNEVP
EGLMDGLITSLIAIHDMKGNGKFQNSTKGSMYIVKPKMHGPEEVAFTNEFFGRVEDALSL
PRFSLKVGIMDEERRTTVNLKACIHAAKERAVFINTGFLDRTGDEIHTSMELGPFIRKGA
MKQATWINAYEQWNVDIGLETGFRGVAQIGKGMWAMPDLMAGMLEAKIGHPKAGANTAWV
PSPTAATLHATHYHQVSVADVQKQLESRTRAALDDILTVPVMDDPASLSAEDIQQELDNN
AQGILGYVVRWIDQGVGCSKVPDINDVGLMEDRATLRIASQLLANWLHHGICSEDQIMET
MKRMAAVVDKQNAGDSAYRPMAGNFDDSVAFQAALDLVLKGREQPNGYTEPLLHAYRLKA
KAKYGQ
NT seq 2181 nt NT seq  +upstreamnt  +downstreamnt
atgacagaacgcgtacaagtcggcggcattcaggtcgcaaagaatctgtatgatttcgtg
aacaacgaagcgatcccgggcaccggaatcgatgccgataaattctgggcagaatttgac
aagatcgtgaacgagctggcgccacgcaaccgtgaattgctggccaagcgtgatgctatc
caggaaaaaatggacagctggaaccgggatcacaagggccagaagctcgacatgggcgaa
tacaagtctttcctgaaagacatcggttacctggttgacgagccttccgagttcaagatc
tccacctccaatgtcgacccggaagtggcaaccatggccggccctcagctggtggtgccg
atcatgaacgcccgttttgctctgaacgctgcgaacgcgcgttggggtagcctgtacgat
gcgctgtacggtaccgacgcgatttccgaggaagacggcgctgaaaaaggccgtggttac
aatccggttcgcggtgcaaaagttatcgagtgggcccgcaacctgctcgacagctcggca
ccgctggcctctggcagtcacaaagatgctgccaagtatgtggttgtaggtggcaaactg
gtcgtcaagctgcagaacggtgagtccaccggcctgaaagacgaagccggctttgttggc
tacaccggtgccgctgatgcgcccaccggcgtactgctggtcaagaacggcatgcacttc
gagatccagatcgatgccactcacccgattggcaaagacgacggtgcccacgtcaaagac
gtactgatggagtctgcactgacaaccatcatggactgcgaagactccgtggccgctgta
gacgccgacgacaaggcgctggcctatcgcaactggctgggcctgatgaagggcgacctg
caggaaaccttcgagaaaggtggcgagcagttgacccgcaagatgaacgcggatcgcacc
tacaccgcggcagacggcagcgagctgagcctgaaaggccgcagcctgatgtttatccgt
aacgtcggccacctgatgaccaacccggccatcctgctgaaagacggtaacgaagtgccg
gaaggcctgatggacggtctgatcacctcgctgatcgccattcacgacatgaagggcaat
ggcaagttccagaacagcaccaaaggctccatgtatatcgtgaagcctaagatgcacggg
ccggaagaggtggcattcaccaacgaatttttcggtcgtgtagaggatgcattgagcctg
ccgcgcttcagcctgaaggtcggcatcatggacgaggagcgtcgcaccacagttaacctg
aaagcctgtatccacgccgcgaaagagcgggctgtgtttattaacaccggtttcctggat
cgcaccggggacgagatccatacctccatggagctgggtccgtttatccgcaagggtgcg
atgaagcaggcgacctggatcaatgcctacgagcagtggaacgtggacatcggcctggaa
accggtttccgtggcgttgcccagattggtaagggcatgtgggccatgcctgacctgatg
gctggcatgctggaagcgaaaatcgggcatccgaaggccggtgcgaacactgcctgggtt
ccatctcccacggcggctacactgcacgccactcactaccatcaggtaagtgtggctgat
gtccagaagcagctggaaagccgcacccgcgccgcgctggacgatatcctgaccgtaccg
gtgatggatgatcccgcttctttgagcgccgaggacatccagcaggagctggacaacaac
gcccagggcatccttggttacgttgtgcgctggattgaccagggtgttggctgctccaag
gtgccggacatcaacgatgtcggcctgatggaagaccgtgcgactctgcgtatcgcctcc
cagttgctggccaactggctgcaccatggtatctgctctgaagatcagatcatggagacc
atgaagcgtatggcagcggtagtcgacaagcagaacgccggtgattcggcgtaccgcccg
atggccgggaacttcgatgacagtgtcgccttccaggcagcgctggatctggttctcaag
ggccgcgagcagcctaatggctacaccgagccgctactgcacgcttaccgtctgaaggcg
aaagccaaatacgggcagtaa

DBGET integrated database retrieval system