KEGG   Marinobacter adhaerens: HP15_239Help
Entry
HP15_239          CDS       T01922                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen-III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
mad  Marinobacter adhaerens
Pathway
mad00860  Porphyrin and chlorophyll metabolism
mad01100  Metabolic pathways
mad01110  Biosynthesis of secondary metabolites
mad01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mad00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    HP15_239 (hemD)
Enzymes [BR:mad01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     HP15_239 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4 Glyco_trans_4_4
Motif
Other DBs
NCBI-ProteinID: ADP96003
UniProt: E4PK72
Position
complement(224678..225487)
Genome map
AA seq 269 aa AA seqDB search
MATHQPEPDLNGRRILICRPEPEASRLASRFRAAGADVHILPLIDREPLPETPERRTLIL
SLDEFSHVIAVSPFAARLLLEEVDTWWPQVPMGIRWYGVGAGTAAVLAEHGLSPRRPPEG
WTSEALLALPSLQNLQHERVLLARGETGRELIRETLEARGARVTLLPLYRRFRPDHAPER
IRATLDTFAPEAIVALSGETLNNLIALCANSGHNLYDRLLIVPADRVAEQARAAGFLNPC
IPGSLADNDIVATVAAQLAGRDGGSGKAK
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggccacacaccaacctgagcccgacctgaacggccggcggattctgatctgccggccc
gagcccgaggcttcgcgcctggccagccggtttcgtgcagccggtgccgatgtacatatc
ctgccactgattgaccgggaacctctgccggaaacgcccgagcgccgcacactcattctg
agcctggatgaattttcccatgtgatcgcagtcagcccgtttgccgcccggctgctgctg
gaagaggtggacacctggtggccccaggtgcccatgggcatccgctggtatggcgttggt
gccggcaccgcagccgtgcttgcggaacacggtctcagcccgcggcggccgcccgagggc
tggaccagcgaggcactactggcattgccgtcactgcaaaacctccagcatgagcgggtt
ctgctcgctcgcggggaaaccggacgcgaactgatccgcgaaacccttgaagccaggggc
gcccgcgtgaccctgctgcccctgtaccgccgctttcgccctgaccacgcgccggagcgg
atccgggccaccctcgatacctttgctccggaggccatcgtcgccctgtcgggcgaaacc
ttgaacaatctcatcgcactatgtgcgaatagcggccataatctatacgataggttattg
attgttcccgcagatcgggttgccgaacaggcccgggcagcgggattcctaaatccgtgt
ataccaggaagccttgccgataacgacatcgtggccacggttgcagcgcaacttgccggc
cgggacggtggctccggaaaagccaagtaa

DBGET integrated database retrieval system