KEGG   Marinobacter adhaerens: HP15_2405Help
Entry
HP15_2405         CDS       T01922                                 

Definition
3'(2'), 5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
mad  Marinobacter adhaerens
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mad00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    HP15_2405
Enzymes [BR:mad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     HP15_2405
Transfer RNA biogenesis [BR:mad03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    HP15_2405
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2538597..2539373)
Genome map
AA seq 258 aa AA seqDB search
MHYSSILPDVIKVADAASEKVLHIYQSDFKVSYKADASPITAADTAAHDIITHGLRSISR
DIPILSEEGSDIPWEERKHWRRFWLVDPVDGTKDFTQRTGEFTVNIAMIEDGQPVMGVVI
APALKEAFWGIVGEGAHMRDRTGRVHHIRVAEPKPLKRVVASKNHLNEETRAFIEALGDH
ELVQAGSSLKLCRIAEGHADIYPRLGPTSEWDTGAAQAVLMAAGGKVQTLDGEPLKYGKQ
NVLNPYFVASGSWYSPRP
NT seq 777 nt NT seq  +upstreamnt  +downstreamnt
atgcattacagctccatccttccggacgtgataaaagtggccgatgcggccagtgagaaa
gtgctgcacatttaccagtctgacttcaaggtgagctacaaggccgacgcttctccaatt
accgctgcagacaccgctgcccacgatatcattacccatgggcttcgaagcatcagccgg
gatatcccgatcctttcggaagagggcagcgatatcccctgggaagagcgcaaacactgg
cgccgcttttggctggtggatcccgtcgacggcacaaaggatttcacccagcgcaccggc
gagttcacggtaaatatcgccatgatcgaagatggccagccagtgatgggggttgtcatc
gcgcctgccctgaaagaagctttttggggaattgtgggagaaggggcccacatgcgggac
cgtaccggcagggttcatcacattcgagtggccgagccaaaacccctgaagcgggttgtt
gccagcaaaaaccacttgaatgaagaaacccgggcattcatcgaggcattgggtgaccat
gagctggtgcaggcgggtagctccctcaaattatgccgtatcgccgaggggcatgcggat
atctacccacggctgggtcctacctctgagtgggataccggtgctgcccaggccgtattg
atggctgccggcggcaaagtgcagacgctggatggggaacccctcaaatatggtaaacaa
aatgtgttaaatccgtatttcgttgcatcgggaagctggtacagtccccggccatga

DBGET integrated database retrieval system