KEGG   Marinobacter adhaerens: HP15_2428Help
Entry
HP15_2428         CDS       T01922                                 

Gene name
hisD
Definition
(GenBank) histidinol dehydrogenase
  KO
K00013  histidinol dehydrogenase [EC:1.1.1.23]
Organism
mad  Marinobacter adhaerens
Pathway
mad00340  Histidine metabolism
mad01100  Metabolic pathways
mad01110  Biosynthesis of secondary metabolites
mad01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mad00001]
 Metabolism
  Amino acid metabolism
   00340 Histidine metabolism
    HP15_2428 (hisD)
Enzymes [BR:mad01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     HP15_2428 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Histidinol_dh
Motif
Other DBs
NCBI-ProteinID: ADP98192
UniProt: E4PH89
Position
complement(2569411..2570715)
Genome map
AA seq 434 aa AA seqDB search
MTAKITRLNASQSDFNDALAKLLAWDDSVDHQVNESVRHILHEVKTRGDQAVLEFTEKFD
RLKVGSVAELEMDQSRLQQALDAIPQDQRVALEKAAERIRDYHERQNQKSWQYEDEDGTV
LGQKVTPLDRAGLYVPGGKAAYPSSVLMNAIPAKVAGVSEVVMVVPTPDGVVNDMVLASA
AIAGVDRVFTVGGAQAVGALAFGTETIPAVDKIVGPGNIFVATAKREVFGVVGIDMIAGP
SEILVISDGKTDPDWIAMDLFSQAEHDEQAQSILISPDAEFLDAVEASINKLLPTMERAD
IIRTSMTDRAALIHVTDLKQAAEVSNRIAPEHLELSVEDPEAMLDDIRHAGAIFMGRYTA
EALGDYCAGPNHVLPTSGTARFSSPLGVYDFQKRSSIIGFSAAGADRMGRVASVLARGEG
LTAHARSAEYRIKD
NT seq 1305 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccaagatcacccgattaaacgcttcccaaagtgactttaatgatgcgttggcc
aaacttttggcctgggacgacagcgttgatcatcaggtgaacgagtcggtgcgccatatc
ctgcatgaggtgaagacccggggtgaccaggcggttctggaatttaccgagaaattcgat
cgcctgaaggttgggtccgtcgccgagttggaaatggatcaaagccgtttgcagcaggcc
ctggacgcgattccccaggaccagcgggttgcccttgaaaaagcggctgagcgaattcgc
gactaccacgaacgccagaaccagaagtcctggcagtatgaggacgaagacggaaccgtg
ctcggccagaaggtaacgcctctggaccgcgcgggcttgtacgtgcctggcggcaaggct
gcttatccgtcctccgtgctcatgaacgcgattccggcaaaggttgcgggcgtcagtgaa
gtggtgatggtcgttccgaccccggatggggttgtaaatgacatggtgttggcctcggca
gcgattgccggagtcgaccgcgtattcaccgttggcggcgcccaggccgtaggcgcgctg
gcctttggtacagaaaccatcccggcggtggataaaatcgtcggccccggcaatattttc
gttgccaccgccaagcgtgaagtgtttggcgtcgtcggcatcgacatgattgccggcccg
tcggaaattctcgtgatcagtgacggaaagaccgatcccgactggatcgccatggatctc
ttctcccaggcagaacacgacgaacaggcccagtccatcctgatcagcccggatgctgaa
ttcctcgacgctgtcgaagccagtatcaacaaattgcttcccaccatggagcgtgccgac
atcatccgcacctccatgactgaccgcgccgcgttgatccatgtcaccgacctgaaacaa
gccgccgaagtctccaaccgcatcgccccggaacacctggagctgtcggttgaagaccca
gaggccatgctcgatgacattcgccacgccggcgccatctttatgggccgctacaccgcc
gaagccctgggtgactactgcgctggtccgaaccacgtgctgcccaccagcggcaccgca
cgtttctcctcacccctgggcgtctatgacttccagaagcggtcctccatcatcggcttc
agcgctgccggtgcagaccgcatgggtcgggtggcgtcggttctggcccgtggcgagggc
ttaacggcacacgcccggtcggcggaatatcgtattaaagattaa

DBGET integrated database retrieval system