KEGG   Marinobacter adhaerens: HP15_251Help
Entry
HP15_251          CDS       T01922                                 

Definition
(GenBank) diguanylate cyclase
  KO
K13590  
diguanylate cyclase [EC:2.7.7.65]
Organism
mad  Marinobacter adhaerens
Brite
Enzymes [BR:mad01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.65  diguanylate cyclase
     HP15_251
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
239531..241024
Genome map
AA seq 497 aa AA seqDB search
MASDQSWKEKYLQELESADNREKQWKAERNTLERMLVRTSLASEGQTPELDRLLARIRKD
LRKNRVDVDAWKDLQDQIDRQVALLDERQSANDRKPSFFSRLAREPEQESQQQQQQVSAE
PLPESSEQPESLPGNEQDIEDNVQRLRIARRVGQLLGQMLTQVSLEPAAEARARALQQSL
LASNDWNELREGLNHVAELVIAAVTRSKREFEAFLKRLDERLELLKEHFSAQSSAQCGRL
DASEHLDREIREEIERVGQRLQESDDLQDLKQSVSRHLESIGQAVGRFRTQESERERALS
EQLEAMQEKVAAMEAHSEQMQEQVRKERLRAMTDLLTELPNREAWQERLSFEYNRWQRYS
HPLTIGVLDIDLFKRINDSYGHKAGDRVLQLVAREFRDRLRTTDFVARFGGEEFVVLFPE
TEPSDARAVVDKLREHVGKLPFHFRGEPVTVTFSAGLAGFIAGDTEESVFDRADRALYQA
KDAGRDQVMISDSADVQ
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggcatcggatcagtcctggaaggaaaaataccttcaggaactcgagtctgcagacaat
cgggaaaagcagtggaaggcggagcggaatacccttgaacgcatgctggtgcgcaccagt
ctcgcctccgaaggccagaccccggagctggatcggttgctggctcgcatccggaaggac
ctgcggaagaaccgggtagatgtggacgcctggaaggacttgcaggatcagattgatcgc
caggtcgccctgctcgatgagcgccagtcggccaacgacaggaagccttcctttttctcc
cgtctggcgcgagagccagagcaagagtcccagcaacagcagcaacaggtcagcgcggaa
cctttaccggaaagcagcgagcagcctgagtccctcccgggcaatgaacaggatatcgag
gacaacgtccagcggttgcgcattgcccgccgtgtgggccagctgttgggtcagatgctt
acccaggtctcccttgagcccgccgccgaggcccgggcacgggcgctgcagcaatctctg
cttgccagtaacgactggaacgaattgcgcgaaggcctgaaccacgtggctgagctggtc
atcgctgcagttacccggagcaagcgagaattcgaagcctttctcaaacgccttgatgaa
cgtctggagctgttgaaggaacacttctcggcccagtcctcggcccagtgcggccggctg
gatgcctcagagcaccttgatcgcgagatccgcgaggaaattgagcgggtcgggcaacgt
ttgcaggagagcgatgaccttcaggatctcaaacagtcggtcagtcgtcatcttgagtcc
attggtcaggcggtaggccgtttccgtacccaggaatccgagcgcgagcgtgcgctctcc
gagcagcttgaggccatgcaggagaaagtggcggccatggaggcccactccgagcagatg
caggaacaggtccgtaaggagaggctccgggccatgaccgacctgcttaccgagttgccc
aaccgtgaagcctggcaggagcgactgtcattcgagtacaaccgctggcaacgctacagc
catccgttgaccatcggtgtactggatatcgatcttttcaaacggatcaacgactcctat
ggtcacaaggccggcgacagggtgttgcagctggttgcgagagagttcagggatcgcttg
cgcaccacggactttgtggctcgttttggcggcgaggaattcgtggtgttgttcccggaa
accgaaccttcggacgcgcgagcagtggtggacaagttgcgggaacatgtcggcaagctg
ccgttccacttccgcggcgagccggtcactgtgaccttctcagccggcctcgcgggattc
attgcgggcgacaccgaggagtcggtgttcgaccgggccgaccgggccctctatcaggcc
aaggacgccggccgggaccaggtgatgatcagcgacagtgccgatgttcagtga

DBGET integrated database retrieval system