KEGG   Marinobacter adhaerens: HP15_251Help
Entry
HP15_251          CDS       T01922                                 

Definition
diguanylate cyclase
Orthology
K13590  
diguanylate cyclase
Organism
mad  Marinobacter adhaerens
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
239531..241024
Genome map
AA seq 497 aa AA seqDB search
MASDQSWKEKYLQELESADNREKQWKAERNTLERMLVRTSLASEGQTPELDRLLARIRKD
LRKNRVDVDAWKDLQDQIDRQVALLDERQSANDRKPSFFSRLAREPEQESQQQQQQVSAE
PLPESSEQPESLPGNEQDIEDNVQRLRIARRVGQLLGQMLTQVSLEPAAEARARALQQSL
LASNDWNELREGLNHVAELVIAAVTRSKREFEAFLKRLDERLELLKEHFSAQSSAQCGRL
DASEHLDREIREEIERVGQRLQESDDLQDLKQSVSRHLESIGQAVGRFRTQESERERALS
EQLEAMQEKVAAMEAHSEQMQEQVRKERLRAMTDLLTELPNREAWQERLSFEYNRWQRYS
HPLTIGVLDIDLFKRINDSYGHKAGDRVLQLVAREFRDRLRTTDFVARFGGEEFVVLFPE
TEPSDARAVVDKLREHVGKLPFHFRGEPVTVTFSAGLAGFIAGDTEESVFDRADRALYQA
KDAGRDQVMISDSADVQ
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atggcatcggatcagtcctggaaggaaaaataccttcaggaactcgagtctgcagacaat
cgggaaaagcagtggaaggcggagcggaatacccttgaacgcatgctggtgcgcaccagt
ctcgcctccgaaggccagaccccggagctggatcggttgctggctcgcatccggaaggac
ctgcggaagaaccgggtagatgtggacgcctggaaggacttgcaggatcagattgatcgc
caggtcgccctgctcgatgagcgccagtcggccaacgacaggaagccttcctttttctcc
cgtctggcgcgagagccagagcaagagtcccagcaacagcagcaacaggtcagcgcggaa
cctttaccggaaagcagcgagcagcctgagtccctcccgggcaatgaacaggatatcgag
gacaacgtccagcggttgcgcattgcccgccgtgtgggccagctgttgggtcagatgctt
acccaggtctcccttgagcccgccgccgaggcccgggcacgggcgctgcagcaatctctg
cttgccagtaacgactggaacgaattgcgcgaaggcctgaaccacgtggctgagctggtc
atcgctgcagttacccggagcaagcgagaattcgaagcctttctcaaacgccttgatgaa
cgtctggagctgttgaaggaacacttctcggcccagtcctcggcccagtgcggccggctg
gatgcctcagagcaccttgatcgcgagatccgcgaggaaattgagcgggtcgggcaacgt
ttgcaggagagcgatgaccttcaggatctcaaacagtcggtcagtcgtcatcttgagtcc
attggtcaggcggtaggccgtttccgtacccaggaatccgagcgcgagcgtgcgctctcc
gagcagcttgaggccatgcaggagaaagtggcggccatggaggcccactccgagcagatg
caggaacaggtccgtaaggagaggctccgggccatgaccgacctgcttaccgagttgccc
aaccgtgaagcctggcaggagcgactgtcattcgagtacaaccgctggcaacgctacagc
catccgttgaccatcggtgtactggatatcgatcttttcaaacggatcaacgactcctat
ggtcacaaggccggcgacagggtgttgcagctggttgcgagagagttcagggatcgcttg
cgcaccacggactttgtggctcgttttggcggcgaggaattcgtggtgttgttcccggaa
accgaaccttcggacgcgcgagcagtggtggacaagttgcgggaacatgtcggcaagctg
ccgttccacttccgcggcgagccggtcactgtgaccttctcagccggcctcgcgggattc
attgcgggcgacaccgaggagtcggtgttcgaccgggccgaccgggccctctatcaggcc
aaggacgccggccgggaccaggtgatgatcagcgacagtgccgatgttcagtga

DBGET integrated database retrieval system