KEGG   Marinobacter adhaerens: HP15_2642Help
Entry
HP15_2642         CDS       T01922                                 

Gene name
pcm
Definition
protein-L-isoaspartate O-methyltransferase (EC:2.1.1.77)
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
mad  Marinobacter adhaerens
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2791932..2792588)
Genome map
AA seq 218 aa AA seqDB search
MNQDNGFELQRASMVDYQLRARGIGSPLVLEAMGRVPRERFIPERMKDCAYDDGPLPIGA
GQTISQPYIVALMTEALDLEGGERVLDIGTGSGYAAAVLSCIASEVFSIERVQELADRAA
RTLAAEGFDNVRVRCGDGTTGWPEHQPFDGIIVAAGAPAVPDSLKHQLAVGGHLVIPVGS
EHSVQSLERITRLTENEFRTEDLGAVRFVPLIGEQGWS
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgaatcaggacaatggcttcgagttgcagagagcgtccatggtggattatcagcttcga
gcccgtggaatcgggtcgccgctggtgctggaggccatgggtcgggtgccgcgtgagcgc
ttcattcccgagcgcatgaaggactgcgcctacgatgatggtcctcttccgataggcgcg
gggcagaccatttcgcagccttacatcgtggcgttgatgacggaagcactggatctggag
ggtggagaaagggttctggatatcgggacaggttcgggttacgcggctgccgttctgagc
tgtattgcaagcgaggtgttcagtatcgaacgggttcaggaactcgccgatcgcgcagcc
cgaacgctggccgccgaggggtttgacaatgtccgggttcgctgtggcgatggcacgaca
ggttggcccgaacaccagcctttcgatggcatcatagtggctgccggtgcgccagcggtg
ccggactcattgaagcatcagctggcggttggcgggcacctggtcataccggtggggtcg
gagcattcggttcagtcgctggaacgtattacccggctgacagagaacgaattccggacc
gaggacctcggcgcagtccggttcgttcccctgatcggtgaacaggggtggtcgtga

DBGET integrated database retrieval system