KEGG   Marinobacter adhaerens: HP15_3173Help
Entry
HP15_3173         CDS       T01922                                 

Definition
Di-heme cytochrome c peroxidase (EC:1.-.-.-)
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
mad  Marinobacter adhaerens
Brite
Enzymes [BR:mad01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     HP15_3173
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3326679..3327875)
Genome map
AA seq 398 aa AA seqDB search
MFVKKLRAGPVWPALLLCVSALLSGCLESSSTTVDDQGARVSSFDWGLPESIPLPREPED
NPMTEAKFQLGRHLFYDRRLSTNSTVSCAGCHQQDKAFSDGVARPFGATGEQHPRNSQPL
VNVAWASTVTWGNPSLGTIERQILLPLFGDDPVEHGLNEANSEQVLRSLQADPTYGPLFQ
AAFPEQNDPLFGDLAWDNVVKALASFVRGLVSFDSKFDRGELSASAQRGERLFNSERLEC
FHCHAGYNFSDATVDRLTTFNQLIFHNTGLYNVDGMGGYPEPNTGRHEVTGDPDHMGQFR
APTLRNIALTAPYNHDGSVETLEGVIRNYAAGGRVLITGPNPGDGRMNPFKDGFITSFAI
SEQEIDDVVAFLESLTDESFITNPRFSNPWNSTGQETP
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgtttgttaagaagcttcgcgcggggcctgtctggcccgcgcttctgctgtgcgtgtcg
gcgctcctgtcgggttgcctggagtccagttccaccacggtggatgaccagggtgcgcgg
gtgtcctcatttgactggggcttgccggaatccatccccctgccgagggagccggaagac
aatccgatgacagaggccaagttccagcttggtagacatctgttttatgatcgcaggctt
tcgaccaatagcacggtcagctgcgctggctgtcatcagcaagacaaggcttttagtgat
ggcgtggcgcgaccgtttggcgccacgggtgagcagcatccgcgtaacagccagccgctc
gtgaatgttgcctgggcatccacggtgacctggggcaacccgagcctcggaaccatcgag
cgccagattctactaccgctctttggcgatgatccggtggagcatggcctgaatgaagcg
aattcggaacaggtgctacggagcctgcaggcagatccgacctacgggccgctattccag
gcggcctttccagagcaaaacgacccgctgtttggcgatctcgcatgggacaacgttgtg
aaggcgctcgcctcgttcgtgcgtggtctggtgtcatttgactcgaagttcgaccggggg
gaactctccgcgtccgcacagcggggcgagcgcctgttcaacagcgagcgtctggagtgc
ttccactgtcacgccggttataatttctccgatgccaccgtggaccggctgaccacgttc
aatcagttgatattccacaacaccgggctttacaacgtggatggcatgggcggctacccg
gaacccaataccggccgccatgaggtgacgggtgatcccgatcacatggggcaattccgg
gccccaacgctgcgtaacatcgccctgacggcgccctacaatcacgatggctccgtggag
acccttgagggagtcatccggaactacgccgctggcggacgggtgctgatcacaggcccc
aaccccggtgatggccgaatgaatccgtttaaggatggattcatcacctcatttgcaatc
agcgagcaggaaatcgacgacgtcgttgctttccttgagtcgctcactgacgaatccttc
atcaccaatccccgcttcagcaatccctggaacagtaccggtcaggaaacaccatga

DBGET integrated database retrieval system