KEGG   Marinobacter adhaerens: HP15_3291Help
Entry
HP15_3291         CDS       T01922                                 

Gene name
trpC
Definition
(GenBank) indole-3-glycerol phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
mad  Marinobacter adhaerens
Pathway
mad00400  Phenylalanine, tyrosine and tryptophan biosynthesis
mad01100  Metabolic pathways
mad01110  Biosynthesis of secondary metabolites
mad01130  Biosynthesis of antibiotics
mad01230  Biosynthesis of amino acids
Module
mad_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:mad00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    HP15_3291 (trpC)
Enzymes [BR:mad01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     HP15_3291 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS
Motif
Other DBs
NCBI-ProteinID: ADP99055
UniProt: E4PQZ8
Position
3449387..3450208
Genome map
AA seq 273 aa AA seqDB search
MTDRHLDKTPTILRRIVDRKWEEIDERKRQVSIADLKAKARDQPAARGFANALRSRIEQQ
TPAVIAEIKKASPSKGILRDPFEPAVIAESYEKGGAACLSVLTDRDFFQGDEDYLVAARN
ACSLPVIRKDFMVAPYQVYESRAIGADCILLIAACLTKDQMQELEGIAHEIGLDVLVEVH
DGEELDDALTLTTPLVGINNRNLHTFDVSLDTTFDLHERISQDRLTITESGIMTRSDVEA
MTARGIYGFLVGESFMRAEEPGQKLQELFFPKG
NT seq 822 nt NT seq  +upstreamnt  +downstreamnt
atgactgacagacatctggataaaacaccgacgatccttcggagaattgttgatcgtaag
tgggaagaaattgacgagcgcaagcgccaagtctcgattgcagatctgaaggccaaagct
cgtgatcaaccggcagcccgaggttttgctaatgctctgcgcagccgaattgaacagcag
actcccgctgttatcgcagaaatcaaaaaagcctcaccaagcaagggcattctgcgggat
ccgttcgaaccagcggtcattgccgagagctacgagaaaggcggcgccgcttgtctttcg
gtactgaccgaccgcgacttcttccagggcgacgaggactatctggtcgccgcccgcaat
gcctgcagtctgcccgtgatccgcaaggacttcatggtcgcgccctatcaggtctacgag
agccgggccattggcgccgactgcatccttctgatcgccgcctgcctgaccaaagaccag
atgcaagagctggaaggtattgcccatgaaatcggtctggatgtgttggtcgaagtgcac
gatggtgaggaactggatgatgcgttgacgctgacgacgcctctggtcggcatcaacaac
cggaacctgcataccttcgatgtttcgctggacaccacgtttgatctgcatgaacgcatc
tcacaggacaggctgacgattaccgagagcggcatcatgacccgcagcgacgtagaagcg
atgactgctcgcgggatttacggtttccttgtgggggaatcgtttatgcgggcggaagag
cctggtcagaaacttcaagaactgttctttccaaaaggctaa

DBGET integrated database retrieval system