KEGG   Marinobacter adhaerens: HP15_3318Help
Entry
HP15_3318         CDS       T01922                                 

Gene name
algC
Definition
phosphomannomutase (EC:5.4.2.2)
Orthology
K15778  
phosphomannomutase / phosphoglucomutase [EC:5.4.2.8 5.4.2.2]
Organism
mad  Marinobacter adhaerens
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Purine metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mad00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HP15_3318 (algC)
   00030 Pentose phosphate pathway
    HP15_3318 (algC)
   00051 Fructose and mannose metabolism
    HP15_3318 (algC)
   00052 Galactose metabolism
    HP15_3318 (algC)
   00500 Starch and sucrose metabolism
    HP15_3318 (algC)
   00520 Amino sugar and nucleotide sugar metabolism
    HP15_3318 (algC)
  Nucleotide metabolism
   00230 Purine metabolism
    HP15_3318 (algC)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    HP15_3318 (algC)
Enzymes [BR:mad01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.2  phosphoglucomutase (alpha-D-glucose-1,6-bisphosphate-dependent)
     HP15_3318 (algC)
    5.4.2.8  phosphomannomutase
     HP15_3318 (algC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3478636..3481278)
Genome map
AA seq 880 aa AA seqDB search
MKLGKKKDADASVDEKPAKKAVKKEKTSSSGPKLKRLNSVAVNQSLVVVLAGVIAVALLH
FLVVQPSAKERFESLKVLEADAAALRLNQYFDQVQKSVNGLATQPHVVQALNSRNEIPTT
EVQLADSLPGIEAVHLFPYRDIPRTSSSEGLLGFSGLELARRAETGQRLFPDAFPRDNRW
FVQMATPVRNPTSNAVIGSLLIIFDSGQIQPLLQVVNSSLGGQLALVQTVSGSPRTVVSN
GSGSGNAESRRLSNPDWTVAYTPAKSSAAPVDTVMIALLVGVPALIAAIIVWVLLGGAQK
GLRQDVTALIQWAHKVFGGERVKLPTFRWDMVASTGEVLYRLSQVVDKRVAKAGETAKPR
PAGSGKAGGGAAKGGDEPLFQDKDMPDIDMLDGDEDVLGFGSGDDTVFGSGDTPDVEEVT
LPQVELPQDIFRAYDIRGIVGETLTAEGVEVIGRAIGSEARERGVDSLCIGYDGRHSSPD
LADALARGVMAAGCNVIHVGAVPTPVLYFATHELQTGSGVMVTGSHNPANYNGLKIMLGG
ETLSGEAIQKLYQRIQTGDFASGRGSQSTEDVRRAYLDRIVGDIAVAAPLKVVVDAGNGI
AGELAPMLIEELGCEVIPLYCEVDGDFPNHHPDPGKPANLADLIARVESEGADIGLAFDG
DGDRLGVVTNSGKIIWPDRLMMLFARDVVSRNPGADVLYDVKCSRRLAGVISEAGGRPIM
WKTGHSLMKAKMKETGALLAGEMSGHIFFGERWYGFDDGLYSAARLLEILGIEDRHSDEV
FEDFPDDISTPELNVQVTESSKFDIIKRLGESGDFGDGNISTIDGIRVDYADGWGLCRAS
NTTPVLVLRFEAETDEALERIKSVFRDQLQKAAPDLVADF
NT seq 2643 nt NT seq  +upstreamnt  +downstreamnt
atgaagctgggtaaaaagaaagatgccgacgcgtccgttgatgaaaagccggcgaagaag
gcggtgaagaaggaaaaaaccagttcttcgggacccaaactgaagagactcaattccgtg
gcggtgaaccagtcgctggtcgtggtccttgcgggggtgattgccgttgccttgcttcat
tttctggtggttcagccgtcggcaaaggaacgcttcgagtcattgaaagttctggaagcg
gatgccgccgcccttcgactgaaccagtattttgaccaggtccagaaaagcgtcaatggt
ctggctacccagccccatgtcgttcaggcgctgaacagccggaacgagattccgacgacc
gaggtgcagctggcggattcactgcccggcatcgaggcggttcatctgtttccctaccgt
gacattccacgcacctccagcagtgagggcctgctaggcttctccgggcttgagctggcc
cggcgcgctgaaaccggccagcgactgtttcccgacgcgtttccacgggataaccggtgg
tttgtccagatggcaaccccggttcgcaatccgaccagcaatgcggtcatcggcagcctg
ctgattatcttcgactccggccagatccagccgttgctgcaagtggtcaactccagcctc
ggtggtcagctcgcgctggtgcagaccgtgtccggttcaccccgcaccgtggtcagtaac
ggcagcggctccggaaacgcggaatcccgccggctttccaatccggactggaccgtagcc
tatacccctgcaaaatcgtccgcagcgccggttgatacggtaatgatcgcgcttctggtc
ggcgtgcccgcgttgatcgctgccatcatcgtctgggtactgttgggcggggcccagaag
ggcttacgtcaggatgtgacggccctgatccagtgggcgcacaaggtgttcggcggagag
cgggtaaagctgccgaccttccgttgggacatggtggcctcaaccggtgaggtgctctac
cgtttgtcccaggtggttgataaacgggtcgccaaggctggagaaaccgccaaacccagg
cccgccggttccggaaaggctggcggtggtgccgccaagggcggcgatgagcctttgttc
caggacaaggacatgcccgatatcgacatgcttgatggcgatgaggacgttctgggcttc
ggcagcggcgatgataccgtctttggttccggcgacactccggacgtggaagaggtgacc
ctgcctcaggtggagcttccccaggatattttccgggcctatgacattcggggtattgtc
ggcgaaaccctgaccgctgagggcgttgaagtcatcggtcgggccatcggttcggaggcc
cgggagcgcggtgtcgacagcctttgcattggttatgacggccgccattccagcccggat
ctggcagatgccctggcacgcggtgtcatggcagccgggtgcaacgtgattcacgtgggg
gccgtgcccacaccggtcctctattttgccacccacgaactccagactggctctggcgtt
atggtgaccggcagtcacaacccggccaactataacggcctgaaaatcatgttgggtggc
gaaaccctttcaggtgaggccatccagaaactgtatcagcgcatccagaccggagatttt
gccagcggtcggggcagccagagcaccgaggatgtgcgccgtgcttacctggaccggatt
gttggcgatattgcggtagcggcaccgctcaaggtggtcgtcgacgccggcaatggcatt
gccggtgagctggcacccatgctgatcgaagagctgggttgcgaagtcattccgctctac
tgcgaggtggacggtgacttcccgaatcaccatcccgacccaggtaagccggcgaatctg
gcggatctgattgcccgggttgaatcggaaggggccgacatcggtttggccttcgacggc
gatggtgaccgtctcggtgtagtaaccaattccggcaagattatctggccggaccggctg
atgatgctgtttgcccgggatgtggtttcacggaatccgggggccgatgtcctttacgat
gtgaagtgcagccgcaggctggccggggtgatttcagaagccgggggccgaccgatcatg
tggaaaaccggtcattccctgatgaaggcaaaaatgaaagagactggcgccttgctggcc
ggggaaatgagtggtcatattttctttggcgagcgctggtacgggtttgatgacggtctg
tattctgcggcccgcctgctggaaattctgggcattgaggatcgtcacagcgatgaagtt
ttcgaggatttcccggatgacatcagtacgccagagctgaatgtccaagtgactgaaagt
tccaagttcgacattatcaaacgcctcggcgagtccggggatttcggtgacggcaatatc
agcaccatcgacggcatccgggtggactacgccgacggctgggggctgtgccgggcatca
aacaccacaccagtgctggtcttacgctttgaagcggagaccgacgaggcactggagcgt
atcaagtctgtgttccgtgaccagctgcagaaggcagcgccggatctggtggcggatttc
tga

  All links  
No link information was found.   
DBGET integrated database retrieval system