KEGG   Marinobacter adhaerens: HP15_3367Help
Entry
HP15_3367         CDS       T01922                                 

Definition
twin-arginine translocation pathway signal
Orthology
K01113  
alkaline phosphatase D [EC:3.1.3.1]
Organism
mad  Marinobacter adhaerens
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mad00790]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:mad00627]
Environmental Information Processing; Signal transduction; Two-component system [PATH:mad02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3533526..3535268)
Genome map
AA seq 580 aa AA seqDB search
MKRLTRRDFLKASAMGMGAVVISTGLAGCVLDSSDKRTISFTHGVASGDPLADGVMLWTR
AAPATGSAPVGVAWEVSTDEGFENLVHSGTAEATEAHDFTVKVDVRGLAPGQSYYYRFQT
TDRQSPVGVTRTLPEGSIDSVRLAVVSCANYPAGYFNVYGEISKQNDLDAVVHLGDYIYE
YSSDSGSYAAQDAQALGRTFSEDNNLELIELVDYRRRYAAYRADPDLQSLHARVPFIVVW
DDHEVANDAWEEGAENHNEGEGDFTQRKLNALKAYFEWMPIRPVIEGSDEAIFRTFRFGD
LVDLHMLDTRIIGRDQQLDYMDYFTGEGLDAARFTADVGSPNRTLLGAEQLLWLQSSLNY
STATWQVLGQQVLMGRMNLPAELLVAIATEQFDGLPEKLAELAQLKGRELQGDPSLTPEE
LARINTVAPYNLDAWDGYQYEREVVLGTAKALNKNLVVLAGDTHNAWANNLKDIQGDQIG
VEFATASVTSPGLEEYLGIPDDMIQGAEQAIGLLVDDLDYLNVNQRGYMLVTFTPEEARA
DWYFVDTIKSKDYQIDASRTASRRVLPGPGNRTVQDTSIG
NT seq 1743 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgactgacacgacgggattttctgaaggcatcagccatgggtatgggcgccgtg
gtgatttcgaccggcctcgcaggctgtgtactggacagctccgacaagcgaacaatcagc
tttacccatggagtggccagcggcgacccgcttgccgatggtgtcatgctctggaccagg
gctgcaccggcgaccggttcggcacctgtcggtgtcgcctgggaggtatcgacggatgag
ggtttcgagaaccttgtgcactccggcacggcagaggccactgaggcccatgacttcacc
gtcaaggtggacgttcgcggcctggcaccggggcagagctactattaccgctttcagacg
accgatcggcagtcaccggtgggcgtaacccggaccttaccggaaggcagtatcgactca
gtgcgcctggccgtggtctcctgcgcgaattatccggccggttatttcaacgtctacggg
gaaatcagtaaacagaatgacctggatgccgtggtccatctgggcgactacatctacgaa
tacagctccgacagcggcagttatgcggcacaggatgcccaggcgctggggaggaccttt
tctgaggacaacaatcttgagctgattgaactggtggactatcgcagacgttacgctgcg
tatcgtgcggacccggatcttcagtccctgcatgcgagagtgccgttcattgtggtgtgg
gacgaccacgaggtggcgaacgacgcctgggaagagggagctgaaaaccataacgagggc
gagggcgatttcacccagcgtaagctcaatgccctgaaggcctatttcgaatggatgccg
atccgccctgttatcgagggcagcgacgaggccatcttccggaccttccggttcggcgac
ctggtggacctgcacatgctcgacacccgaattatcggtcgcgaccagcaactggactat
atggactactttacgggagaaggattggatgccgcccgcttcactgcggatgtcggcagt
ccgaatcgtaccctgctgggtgcggagcaactgctctggctgcagtcttccctgaactac
tccaccgcaacgtggcaggtgttggggcaacaagtcctcatgggccgaatgaatctgcct
gcggagctgctggtggccattgctactgagcagtttgacggtctgccggaaaaactggcg
gaactggcccagctcaaaggccgggagctccagggggatccgtccctgacaccagaggaa
ttggctcgcatcaatacagttgccccctacaatctcgacgcctgggatggctaccaatat
gaacgggaagtggttctgggaacggccaaggcgctgaacaagaacctggtggtactggcg
ggggatacccataacgcctgggccaataacctgaaagacatccagggcgaccagattggc
gtggagttcgctacagcgtcggttacatcacccggcctggaggagtatctgggcattcct
gatgacatgattcagggcgcggaacaggccattggtctgctggtggatgacctggattac
ctgaacgtgaatcagcgtggctacatgctggtgacctttacgcccgaagaagcccgggcc
gactggtatttcgtggacaccatcaagtcaaaggattatcagatcgacgcgagccgcacc
gcttcccggcgggtattgcccggtcccggaaatcgtacggtgcaggacacaagcatagga
taa

DBGET integrated database retrieval system