KEGG   Marinobacter adhaerens: HP15_3493Help
Entry
HP15_3493         CDS       T01922                                 

Gene name
mutM
Definition
formamidopyrimidine-DNA glycosylase (EC:4.2.99.18)
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
mad  Marinobacter adhaerens
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:mad03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3678473..3679210
Genome map
AA seq 245 aa AA seqDB search
MTVRNGSLRWPVPADLGEKLEGQVIKSVDRRAKYLFLNMDRGTVIVHLGMSGSLRIITDN
TPPLTHDHIDVALQSGVILRFNDPRRFGCWLWADSAEEHPLITHLGPEPLAPEFNGAHLF
RLSRGKNTPVKSFIMDNQVVVGAGNIYANEALFKSGIHPRRKAGRISLDRYHRLAEAIRE
TLSAAILMGGTTLRDFVNSDGKPGYFAQSLLVYGRGGQPCKECGAPLKEIRMNNRSTVYC
PRCQR
NT seq 738 nt NT seq  +upstreamnt  +downstreamnt
gtgacagtccgcaacggcagtctgcgctggcctgttccggccgatctgggcgagaaactg
gaaggtcaggtgattaaaagtgtagaccgccgggccaagtatttgttcctgaacatggac
cggggcacggtgattgttcaccttggcatgtccggcagcctgcgcatcatcactgacaat
acccctcccctgacccatgatcatatcgacgtggcattacagtctggcgtcatccttcga
ttcaacgacccacgccggttcggctgctggctgtgggctgattccgccgaagagcacccg
ctgatcacccacctgggtccggaacccctggccccggaattcaatggcgcgcacctgttc
cggctctcccgcggcaaaaacacaccggtgaaatcgttcatcatggacaatcaggtggtc
gtgggtgccggtaacatctatgccaatgaagcgctgttcaaatcgggcattcatccccgg
cgcaaggccgggagaatcagcctcgaccgctatcacaggctggccgaagccatccgggaa
acgctcagcgccgccattctgatgggcggaaccacccttcgggacttcgtgaacagcgat
ggcaagcccggctattttgcccagtccctgctggtgtacggccggggcggccagccctgc
aaggaatgcggggcaccactgaaggaaatccggatgaacaatcgctcaacggtttactgt
ccccgttgccagcgctga

DBGET integrated database retrieval system