KEGG   Marinobacter adhaerens: HP15_352Help
Entry
HP15_352          CDS       T01922                                 

Gene name
argC
Definition
N-acetyl-gamma-glutamyl-phosphate reductase (EC:1.2.1.38)
Orthology
K00145  
N-acetyl-gamma-glutamyl-phosphate reductase [EC:1.2.1.38]
Organism
mad  Marinobacter adhaerens
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
2-Oxocarboxylic acid metabolism
Biosynthesis of amino acids
Module
Ornithine biosynthesis, glutamate => ornithine
Class
Metabolism; Overview; 2-Oxocarboxylic acid metabolism [PATH:mad01210]
Metabolism; Overview; Biosynthesis of amino acids [PATH:mad01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:mad00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
347025..348191
Genome map
AA seq 388 aa AA seqDB search
MDCQKDSDNIVTVALRAAISHWFIMVDYGVKALNSDTTSLEKMVIKVGIVGGTGYTGVEL
LRILAVHPEVSVSCITSRSEAGMPVAEMYPNLRGHYDLAFSEPDVNVLGACDLVFFATPH
GVAMRMVPELMSAGVRVVDLSADFRLKDLDVWANWYGMAHESPEWAEKAVYGLPEVVRDE
IRNAQLVANPGCYPTAVQLGFLPLLEQGLVDPKRLIADAKSGASGAGRQGKIGMLHGEIG
ESFKAYGASGHRHLPEIRQGLCGAAGGDVGVTFVPHLIPMIRGIEATLYAELKNPADFDR
LQALFEQRFDDEPFVDVMPFGSHPETRSVRGANQCRMALHRQEQSNIVIVSSVIDNLVKG
AAGQAVQNMNIMFGLKETMGLEAPALLP
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggactgccagaaggattctgacaacattgtaacggtcgccctgagggctgcaataagt
cattggtttatcatggtagactacggcgttaaagctcttaattctgatacgacgtcgctg
gagaaaatggtgattaaagtaggcatcgttggtggcaccggctacaccggtgtggaactg
ctgagaattcttgcggttcaccctgaagtttcggtcagttgcattacctcccgttccgag
gcgggtatgccggttgcggagatgtaccctaatttgcgaggccattacgacctcgcgttc
tcagagccggacgtcaatgtgcttggggcctgcgatctggtgttcttcgccacgccccat
ggcgtggccatgaggatggtgccggaactgatgtccgccggcgtacgtgtagtggatctg
tccgccgatttccgtcttaaggatctggatgtctgggccaactggtatggcatggcccat
gagagcccggaatgggcggagaaggcggtttacggtttgccggaagtggtgcgcgatgaa
atccgcaatgctcaactggtggccaatccgggttgctatccgactgcagttcagctggga
ttcctcccgttgctggagcagggactggtggatccaaagcgcctgatcgccgacgccaaa
tccggcgccagcggcgcgggcaggcagggcaagatcggcatgctccacggggagatcggt
gaaagcttcaaggcctacggcgcctcggggcatcgtcatctgccggaaatccgccagggt
ttgtgcggtgctgctggcggggatgtgggtgtgacgttcgtgccccacctgattccgatg
atccgcggcatcgaggcgacgctctacgccgagctgaagaatccggcggactttgatcgg
ctccaggccctgttcgagcagcgttttgatgacgagccttttgtcgatgtgatgcctttc
ggcagccatccggaaacccggagcgtgcgtggggcgaaccagtgtcgcatggcactgcac
aggcaggaacagagcaacattgttattgtttcttccgtcattgataacctggtgaaaggt
gcggccgggcaggcggtccagaatatgaacatcatgtttggcctgaaagaaaccatgggg
cttgaggccccggcgcttttgccttga

DBGET integrated database retrieval system