KEGG   Marinobacter adhaerens: HP15_3529Help
Entry
HP15_3529         CDS       T01922                                 

Gene name
folE
Definition
GTP cyclohydrolase 1 (EC:3.5.4.16)
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
mad  Marinobacter adhaerens
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mad00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3716667..3717236
Genome map
AA seq 189 aa AA seqDB search
MSKLLDDLSGHFRAIIDGLGEDPDREGLQDTPMRAAKAMQFLTCGYQQDLGDLVNNAVFE
SAMDEMVVVQDIELYSMCEHHMLPFIGKCHIAYLPAGKVLGLSKFARIVDMYARRLQIQE
NLTRQIAEAVESVTGAKGVAVVIEAQHMCMMMRGVEKQNSRMKTSMMLGQFRKSQATRTE
FLTLISNNR
NT seq 570 nt NT seq  +upstreamnt  +downstreamnt
atgagtaaactccttgacgacctctcagggcacttccgtgccatcatcgatggcctgggc
gaagacccggatcgcgagggtctgcaagacactccaatgcgcgcggccaaggccatgcag
ttcctcacgtgcgggtaccagcaggaccttggcgacctggtgaacaatgcggtattcgaa
tcggccatggatgaaatggtcgtggttcaggatatcgaactctacagcatgtgcgagcac
catatgctgccgttcatcggcaagtgccacattgcctacctgcccgcaggcaaggtactg
ggcttgtccaagtttgcccgcatcgtcgacatgtacgcccgccgtctgcagatccaggaa
aacctgacccgacagattgccgaagccgttgagagcgtcacgggcgccaagggcgtggcc
gttgtcatcgaagcccagcacatgtgcatgatgatgcggggcgtggagaaacagaattcc
cgcatgaaaacctcgatgatgctggggcagttccgcaaatcccaggcgacccgcacagag
tttctgacgctgatcagtaacaatcgctga

DBGET integrated database retrieval system