KEGG   Marinobacter adhaerens: HP15_3712Help
Entry
HP15_3712         CDS       T01922                                 

Definition
exonuclease V subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
mad  Marinobacter adhaerens
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:mad00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    HP15_3712
Enzymes [BR:mad01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     HP15_3712
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3921263..3923536)
Genome map
AA seq 757 aa AA seqDB search
MSRSRSQTGKSDHQIDLFAEDIAAETPTIPAAGDTTFAIKDLLSSPDKTESLLLHWQQAE
WIRALDVGFARLIRELSEEQGERPDPLLLLLAALVSHQVGRGHVCVDLGNLLADAGHTLS
LPPEESVQEPLTDSGTSEPDRPKPADVLALVTLPECLSILESACAVSDGSHTTPLVLNGT
RLYLRRFWRYEQRIAAGIRHRLALPSPLADPESGPARTLSLALDTLFRSSEPVDYQKLAC
ALAARNHFAVITGGPGTGKTTTVVNLLAALQAVAGESPERAGRKYRIRLAAPTGKAAARL
NESIGGAVSRLPLAELPGNVDLNDIPTRVTTLHRLLGSRPDTRKFRHNRDNPLLVDILVI
DEASMVDVDLMASVFDALPANAQLILLGDKDQLASVDAGAVLGELCQRALLAHYTPETAR
WLAAMAGSEIPESLVDETGQPMDQAVAMLRKSYRFREDSGIRAFAEAVNTNALDNAMLRQ
IREAEFDDVILLNGRSKSGDTEDTLDLVCRHAITGSPEAFRNAGQGRQVNGQSLPPPVGY
RHYLERLQNHGLNESSPREDWDAMAVQLLEAFSDFQVLCALRKGPWGVEGLNDRIARQLL
AEKLISRAEGWYEGRPVLITGNDYNLGLMNGDIGIAVNVPWDRTDTGEPRYTLRVAFPDS
DTAGGIRWISPSRLQQLETVYAMTVHKSQGSEFNHTCLVLPDRLSPVLTKELVYTGITRA
RNWFSLIAGDIPVLREAVSQQVSRASGLALALVESTD
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgagccgttcccgctcccaaaccggaaagtccgaccaccagattgatctgttcgcggag
gacatcgctgcggaaacgccgaccatacccgctgccggtgataccaccttcgctatcaaa
gatctgctctcgagcccggataaaaccgagtccctgctgctgcactggcagcaggcggag
tggatccgcgcgctggatgtggggtttgcccggctgatccgggagctctcggaagagcag
ggcgaacgcccggacccactgctcctgctgctggcggcactggtctcccatcaggtgggg
cgtggccatgtctgcgtcgatctgggcaatctcctggccgatgccgggcataccctttca
ctgccgccagaggagtcggtccaggagccgctcaccgattccggcaccagcgagccggac
cgtcccaagcccgccgacgtgcttgcacttgtaacgctgccggaatgcttgagcatactg
gaaagcgcctgcgccgtaagtgatggctcacatacaacacccctggtgctgaacggaacc
cggctctatctgcgcagattctggcgctacgaacaacgcattgcggcgggtatccggcac
cgcctggctttgccatcacccctggcagatccggaatccggtccggcccgcaccctgtct
ctcgctctggatacactgttccggtcgtcagaaccggtggattaccagaaactggcctgt
gccctagcggcccgcaaccatttcgccgtgatcaccggcgggccgggcaccggcaagacc
accaccgtggtcaatcttctggcggcacttcaggccgtcgccggggaatcccccgaacgg
gccggtcggaaataccggatccgcctggcagccccgaccggcaaggcggcggcccgactg
aacgaatccatcggtggtgcagtgagccggttaccccttgccgaactgccgggcaacgtg
gacctgaatgatatccccaccagggtcactaccctgcaccggttactgggcagccggccg
gatacccgcaaattccgccataaccgggacaaccctttgctggtggatatcctggtgatc
gacgaggcctcaatggtggacgtggatcttatggcgtcggtgtttgatgccttgcccgcc
aacgcccagctgatcctgttgggcgacaaggaccagctggcctcggtggacgccggtgcg
gtactgggggaactttgccagcgggcgttgctggcgcattacactccggaaactgcccgg
tggctggccgccatggccggaagcgagataccggagtcactggtggacgaaaccggccaa
cccatggatcaggccgtggccatgctgcgcaagagctaccggttccgggaggacagcggt
atccgcgcctttgccgaagcagtgaacactaacgcgcttgataacgccatgttgcgccag
atccgggaagcggaattcgacgatgtcattttgcttaacggccggtcgaaaagtggggat
acggaagacaccctggacctggtgtgtcgacatgccatcaccggctcaccagaggcattc
cgaaatgccgggcagggccggcaagtgaatggtcagagcctgccaccacccgttggttac
cgccattacctcgaacgcttgcagaatcatggcctgaacgaaagcagcccccgcgaagac
tgggatgcgatggcggtgcagctccttgaagccttcagtgacttccaagtgctctgtgcc
ctgcgcaagggcccctggggcgtggaaggcctgaacgaccggatcgcaaggcagttactg
gctgaaaaactgatttcgcgggccgagggctggtatgagggccggcctgtgctgattacc
ggcaacgactacaacctgggcctgatgaacggcgacattggcattgccgtcaacgtgccc
tgggatcggaccgacaccggtgagccccgctataccctgcgagtggcgtttccggatagc
gacaccgctggcggtattcgctggatctcgcccagtcgtctgcagcagctggaaaccgtg
tacgccatgacggtgcacaaatcccagggttcggagttcaaccacacctgcctggtcttg
ccggaccgtttgagcccggtcctgacaaaagagctggtctataccggcatcacccgcgcc
agaaactggttcagcctgattgccggggacattccggtgctcagggaggccgtctcgcag
caggtctccagggcctcaggtttggcgctcgcacttgtggaatctactgactaa

DBGET integrated database retrieval system