KEGG   Marinobacter adhaerens: HP15_3944Help
Entry
HP15_3944         CDS       T01922                                 

Definition
alcohol dehydrogenase zinc-binding domain-containing protein
Organism
mad  Marinobacter adhaerens
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4173569..4174675
Genome map
AA seq 368 aa AA seqDB search
MDRQAKAVVCREWGQPVQVETITVEGPKRDEITIKIAACGVCHSDLSATTGKIPYPPPLV
LGHEAAGVVVEVGEGVTAFKEGDHVVSTFISMCGKCSQCVRGRPVLCENARKAMFNLPDG
TVRTKGADGEPLNVFGACGVMAEFATMHVDNCVKVDETVPMQNAALVGCAVMTGVGAVFN
TAKLEPGSRAAVFGIGGVGLNAIQGCVTAGAEMVVAVDSNPAKLAMAKEFGATHTVNINE
VEDAAKAVKKMTGGVDYAFECVGAGPVVEQAYKSLGRGGTAVVVGVADPKDKTSLTTLTL
PADERTLKGSWLGSARPQHDFPRILGLYKAGKLKLDELVTRTYPIEEAAQAFDDMVAGKN
ARGVIVFE
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atggacagacaagcaaaagccgtcgtctgccgggaatgggggcagcctgttcaggtggaa
accatcacggtagaaggccccaagcgggatgaaatcaccatcaagatcgcggcctgcggt
gtttgccacagcgatctgtccgccaccacgggtaagattccctacccgcctccccttgta
ttggggcacgaagccgccggcgtggttgtcgaagtcggtgagggcgtcacggccttcaag
gaaggcgaccatgtggtgagtaccttcatatccatgtgcggcaaatgcagccagtgtgtt
cgtggccgcccggtgctctgtgagaacgcccgcaaggccatgttcaacctgccggatggc
acggtcagaaccaaaggcgcggacggcgagcccctgaacgtcttcggcgcctgcggcgtg
atggccgagttcgccaccatgcacgtcgacaactgcgtaaaagtggatgaaaccgtgccg
atgcagaacgccgccctggtgggttgcgctgtgatgaccggtgtcggcgctgtcttcaat
acggcaaagctggagcccggctcccgagccgccgtgtttggcatcggtggcgttggcctc
aacgccatccagggctgtgtgaccgccggcgccgagatggtcgtggcggtggacagcaac
cccgccaagctggcgatggcgaaagagtttggtgccacccacaccgtgaatatcaacgag
gtagaggacgccgccaaggctgtgaagaaaatgaccggcggcgttgactacgccttcgaa
tgcgtcggtgccgggccggtggtggaacaggcctacaagagtctgggccgtggcggtacc
gccgtggtcgtgggtgtggcagacccgaaggacaagacctcgctgaccaccctcaccctg
ccggcggacgagcgaaccttgaaaggcagctggctgggttcggcaaggccgcagcatgat
ttccccaggatcctgggtctttacaaggctggtaaactcaagctggatgaactggttacc
cggacctaccccatagaagaagccgcacaggcgttcgatgatatggtggcaggcaagaac
gcccgtggcgttatcgtatttgaatga

DBGET integrated database retrieval system