KEGG   Marinobacter adhaerens: HP15_4035Help
Entry
HP15_4035         CDS       T01922                                 

Gene name
mhpF
Definition
acetaldehyde dehydrogenase (EC:1.2.1.10)
Orthology
K04073  
acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
mad  Marinobacter adhaerens
Pathway
Phenylalanine metabolism
Benzoate degradation
Pyruvate metabolism
Dioxin degradation
Xylene degradation
Butanoate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Module
Catechol meta-cleavage, catechol => acetyl-CoA / 4-methylcatechol => propanoyl-CoA
Brite
KEGG Orthology (KO) [BR:mad00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    HP15_4035 (mhpF)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    HP15_4035 (mhpF)
   00650 Butanoate metabolism
    HP15_4035 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    HP15_4035 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HP15_4035 (mhpF)
   00622 Xylene degradation
    HP15_4035 (mhpF)
   00621 Dioxin degradation
    HP15_4035 (mhpF)
Enzymes [BR:mad01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     HP15_4035 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4271539..4272474
Genome map
AA seq 311 aa AA seqDB search
MSKKIKAAIIGSGNIGTDLMIKILRNGKNIEMGAMVGIDPESDGLARAARMGVATTHEGV
DGLVKMPEFADIDIVFDATSAKAHMHNEVFLRGHKESIKIIDMTPAAIGPYCVPVVNLEQ
QLQEGNVNMVTCGGQATIPMVAAVSRVAKAHYAEIVASISSKSAGPGTRANIDEFTQTTS
RAIEVVGGAQKGKAIIILNPAEPPLLMRDTVYVLSDAADKAEVEASVEEMVQAVNSYVPG
YRLKQKVQFDDIPEDQPMNVPGLGRFSGLKTSIFLEVEGAAHYLPAYAGNLDIMTSAALG
TAERIAESLVN
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagaaaataaaggcagccatcatcggctcgggcaacatcggcaccgacctgatg
atcaagattctgcgcaatggcaagaacattgaaatgggcgccatggtcgggatcgatccg
gaatcggacggtctggcccgtgctgcccggatgggcgtggccaccacccacgaaggggtg
gatggactggtgaagatgccggaattcgccgacatcgacattgtattcgatgcaacctcc
gcaaaggcccacatgcacaacgaggtttttctgcgcggccacaaggagagcatcaagatt
attgatatgacgcctgcggcgatcggcccctactgcgtgccggtggtgaaccttgagcag
cagcttcaggaaggcaacgtcaacatggttacctgcggcggccaggccaccattcccatg
gttgcggcggtttcacgagtggccaaggcccactacgccgaaatcgttgcctcgatttcc
tcgaagtccgccggccccggtacccgcgccaatatcgacgagtttacccaaaccacgtcc
cgggccattgaggtggtgggcggtgcccagaagggcaaggccatcatcatcctgaatccg
gccgagccgcccctcctgatgcgcgataccgtgtacgtgctctccgacgcggcagacaag
gctgaagtggaggcctcggtggaagaaatggtccaggccgtaaacagctatgtgccaggc
taccgcctgaagcagaaagtgcagtttgatgacatccccgaagaccagcccatgaacgtt
ccaggcctgggtcgcttcagcggcctgaagacctccatcttcctggaagtggagggcgcg
gcccactacctgccggcctatgcaggcaatctggacatcatgacctccgccgctctcggt
accgccgagcgcatcgccgaatcgctggtcaactga

DBGET integrated database retrieval system