KEGG   Marinobacter adhaerens: HP15_587Help
Entry
HP15_587          CDS       T01922                                 

Definition
hypothetical protein
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
mad  Marinobacter adhaerens
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:mad00790]
Metabolism; Metabolism of cofactors and vitamins; One carbon pool by folate [PATH:mad00670]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
607982..608491
Genome map
AA seq 169 aa AA seqDB search
MRKALIVAMSRNRVIGRNNNLPWYLPGDLRYFKQATMGKPIIMGRKTWDSIGRPLPGRMN
VVISRNEAWEAPTGTVAAKSLPEALVKAEAQAELEGGDEVMIIGGGQIYAEALPMVDRMY
ITQVHAEVDGDAFFPEVNWDEWEEIGREDFSASDNNPYDYSFVVYQRQA
NT seq 510 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaagccctgatcgttgccatgtcccgtaaccgggtcatcggccgcaataacaat
ctgccctggtatctgccgggtgacctccgttatttcaagcaggccaccatgggcaagccc
attatcatgggtcggaagacctgggattccatcggtcggccgctgccggggcggatgaac
gtggtgatctcgcgcaatgaagcctgggaagcgccaaccggaacagtggctgcgaagtct
ttgcccgaagcgctggtgaaggccgaggcgcaggcggagctggaaggtggtgacgaagtg
atgattatcggtggcgggcagatctacgccgaggcattgccgatggttgatcggatgtac
atcacccaggtgcacgctgaggtggacggcgatgcgttttttccggaagtaaactgggat
gagtgggaagaaatcggacgggaggatttctccgcgtccgataacaacccttacgactac
agtttcgtggtctatcagcgtcaggcttaa

DBGET integrated database retrieval system