KEGG   Marinobacter adhaerens: HP15_763Help
Entry
HP15_763          CDS       T01922                                 

Definition
protein-disulfide isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
mad  Marinobacter adhaerens
Brite
Enzymes [BR:mad01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     HP15_763
Secretion system [BR:mad02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   HP15_763
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
772075..772875
Genome map
AA seq 266 aa AA seqDB search
MIPGLCQYCPGCLTAYWKRLFARMNMKHVVVALGVVLGAFGAASVSAGEVEDRISERLTQ
AVPGLKVVSVKESEAKGLYEVQSNNGDTIYATEDGQYLMTGDLLKITDQGIANVTEAART
EARREMMADYGNKGVISFPAKNEKAVVNVFTDIDCPYCRKLHDEVPQLNDYGITVNYYAF
PRSGPNTASFKKYESVWCADDQQAAMDAAKAGRSVPDASCENPVGEQYELGGRVGVTGTP
AIVLEDGNMVRGYVPAQRLAEGLGLL
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
ttgattcccggcctgtgccaatactgcccgggttgtttaactgcttactggaaaaggttg
tttgccagaatgaatatgaaacatgtggttgtggcgcttggagttgtcctgggtgccttt
ggcgcggccagcgtcagtgccggtgaagtggaagaccggatttccgagcgtctgacccag
gctgtccccggcctcaaggtggtgtcggtaaaagaatccgaagccaagggcctctatgag
gttcagagcaataatggcgacaccatctacgcgaccgaggatggccagtacctgatgacg
ggagatcttctcaagattaccgatcagggcattgccaatgtcaccgaagccgcccgcacg
gaggcccgtcgcgaaatgatggcggactatggtaacaagggagttatcagcttcccggcg
aaaaacgaaaaggccgtggtaaacgtgtttactgatatcgactgcccttactgccggaag
ctgcatgacgaggtgccgcagttgaatgactatggcattaccgtcaattactacgcgttt
ccacgatccggccccaatacagcgtctttcaagaagtatgagtcggtctggtgtgctgac
gatcagcaggcggccatggacgcagccaaggccggccgctcagtacccgacgccagttgc
gaaaatccggtgggcgagcagtatgagcttggtggccgggtaggggtcacagggacacct
gccattgttctggaagatggcaacatggttcgtggctatgtcccggcccagcgtctggcg
gaaggcctcgggttactctga

DBGET integrated database retrieval system