KEGG   Marinobacter adhaerens: HP15_765Help
Entry
HP15_765          CDS       T01922                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mad  Marinobacter adhaerens
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mad00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    HP15_765 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    HP15_765 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    HP15_765 (thrC)
Enzymes [BR:mad01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     HP15_765 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
774334..775734
Genome map
AA seq 466 aa AA seqDB search
MRYISTRGEAPALGFEDVLLTGLATDGGLYVPESLPHFDLEEIRSWRGLSYSELAFNVMY
PFVDDAIPADDFRKMLDETYSVFAHKAVAPLVQLDTNEWVMELFRGPTLAFKDFALQLLG
RLLDYVLEKRKQHVVIMGATSGDTGSAAIEGCRRCEHVDIFILHPYQRVSEVQRRQMTTV
QGENIHNIAVRGNFDDCQRMVKESFGNQSFLGGKTQLAAVNSINWARIMAQIVYYFHASL
ALGGPDRSMAFSVPTGNFGDIFAGYLAKKMGLPISQLVIATNRNDILHRFMSGNKYEQHQ
LEHTLSPSMDIMVSSNFERLLFDLHGRDGLAVKTLLENAAKGPVSIEDYRWKHARKLFDS
DAVDDKATCDTIREIYEQNEYLLDPHTAIGVRAARNCRRDQAVPMITLGTAHPAKFPDAV
AESGVSVEPPLPAHMADLFEREERYTVLDNNIDGVQAFIAKHWKNA
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
gtgagatacatcagtacgcggggtgaagcgcccgcactgggctttgaggatgttctgctg
accggtctggcgacagacggcggcctctatgttcctgaatccctgccacattttgatctg
gaagaaatccggagctggcgcgggctttcgtacagtgagctggcgttcaacgtaatgtac
ccgttcgtggatgacgctatccctgcggatgatttccgcaagatgctggacgagacctac
tcggttttcgcccacaaggccgtggccccactggttcagctggataccaacgagtgggtg
atggagcttttccgcggcccgacgctggcgttcaaggatttcgccctccagctgttaggg
cgtctcctcgactatgttctggagaagcgcaagcagcacgtggttatcatgggagcgacc
tccggtgacaccggctcggctgccattgagggttgtcgccggtgcgagcacgtggatatt
ttcattctgcacccctatcagcgggtgtcagaggttcagcgccgtcagatgaccaccgtc
cagggtgaaaacatccacaacattgcagtgcgtggcaacttcgacgactgtcagcgcatg
gtgaaggagagtttcggcaaccagtcgttcctgggtggcaaaacccagctggcagctgtc
aactccatcaactgggcccggatcatggcccagatcgtctactacttccatgcctccctg
gcactgggcggtccggatcggagcatggcgttttctgtgcccaccgggaacttcggcgat
atctttgccggctaccttgccaagaagatggggctgccaatctcccagctggtcattgcc
accaaccgtaacgatatcctgcatcgcttcatgagtggtaacaaatacgagcagcaccaa
ctggaacacaccctgtctccgagtatggatatcatggtgtccagcaattttgagcgcctg
ctctttgatctccacggccgggacgggctggcggttaaaaccctgctggaaaacgctgcg
aaggggcccgtcagtatcgaggactatcgctggaagcatgcgcgcaagctttttgacagc
gatgcggtggacgacaaggccacctgcgacaccattcgtgagatctacgagcagaacgag
tatctgctggatcctcacaccgccatcggcgtccgtgcagcgcgcaactgccgccgtgat
caggcggtgccaatgattaccctgggtaccgcacacccggccaagttcccggatgccgtg
gcagagtctggcgtcagtgtagagccgccgctgccggcgcatatggccgacctgttcgag
cgggaagagcggtataccgtattggataacaatatcgacggtgtgcaggcattcattgcc
aagcactggaaaaacgcctga

DBGET integrated database retrieval system