KEGG   Marinobacter adhaerens: HP15_923Help
Entry
HP15_923          CDS       T01922                                 

Definition
acetyl-coA synthetase/AMP-(fatty) acid ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
mad  Marinobacter adhaerens
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mad00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    HP15_923
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    HP15_923
   00620 Pyruvate metabolism
    HP15_923
   00640 Propanoate metabolism
    HP15_923
  Energy metabolism
   00680 Methane metabolism
    HP15_923
Enzymes [BR:mad01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     HP15_923
Lipid biosynthesis proteins [BR:mad01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   HP15_923
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
937153..938802
Genome map
AA seq 549 aa AA seqDB search
MSLPEYTDVYNNFDPAALEADILDGRLDSGLNVCHEICDKWADDPSRVALYYETEDGGDG
TLTFAELKEASARFANYLKSQGIGKGDRVAALLPRTPELLIVIAGTLRAGAVYQPLFTAF
GSGAIEYRFERASTKLVVTNPENYPKLNDVKVCPPVVGVNASEIGADIPDFEETLAAQSS
DFEPVMIKGDDPFLQMFTSGTVGKSKGVAVPAKALLAFYVYMKYAIDLQDGDRFWNVADP
GWAYGLYYAVVGPLLMGHATHFNPGGFTPESTYDMIRKYKITNLAAAPTAYRLLKANDHV
LPEGENLGLRVASSAGEPLNPEVVNWIRNRHYCPVKDHYGQTETGMTCCNFHGLAHPVRE
GSMGYASPGHKVVALNEKNEVVGEGEVGQLAVDVKASPLFHFDGYTWGEKDPFVNGYYLT
GDMVINHGNGNFSFSGRDDDIITTAGYRVGPADVESTLLEHAAVAESGVVGKPDEKRGSI
IKAYVVIKGDYALGDEQALKDELQELVRRRLSTHAFPREIEFVDELPKTPSGKIQRFVLR
NQAKEEIGA
NT seq 1650 nt NT seq  +upstreamnt  +downstreamnt
atgagccttccggaatataccgacgtttacaacaacttcgatcctgctgctctggaagcg
gacatcctggatggacgtctggatagcgggctcaacgtatgtcacgaaatctgcgacaaa
tgggcagatgacccgagtcgggttgcgctttactacgaaaccgaagatggcggtgacggc
actctgactttcgccgagctgaaagaggcctctgcgcgttttgccaattatctgaaatcc
cagggcatcggaaagggcgaccgggtggctgcactcctgccgcgcactccggagctgctg
atcgttatcgccggaaccctgcgtgctggtgccgtgtatcagccgctgttcacggccttt
ggttccggggccatcgagtaccggttcgagcgagccagcaccaagctggtggttaccaac
ccggagaactatcccaagctgaacgatgtcaaagtctgcccgccggttgtgggtgtaaat
gccagtgagattggcgcggacatccctgacttcgaagagaccctggcggcccagtcgagc
gatttcgagcctgtcatgatcaagggcgacgatccgttcctgcagatgttcacttctggc
accgtgggtaagtccaagggggttgcggtaccggccaaagcgctgctggcgttctacgtt
tacatgaaatacgccattgatctgcaggatggtgacaggttctggaacgtggccgatccc
ggttgggcctacggtctttactatgccgtggttgggccgctgctgatgggccacgccacg
cacttcaacccgggtggttttaccccggaatccacctacgacatgatccgcaagtacaag
atcaccaacctggctgcggcgcctacggcttaccgtttgctcaaggcaaacgatcacgtg
ctgccggaaggcgagaacctgggccttcgggttgccagcagtgccggcgagcctctgaac
ccggaagtggtgaactggattcgcaaccgtcactactgcccggttaaagatcattacggc
cagaccgagactggcatgacctgctgcaacttccacggtctggcgcatccggtccgtgaa
ggctccatgggctatgcctctcctggccacaaggtggtcgcgctgaacgagaaaaacgag
gttgtaggcgagggtgaagttggtcaactggcggttgacgtaaaagcgtccccgcttttc
cacttcgacggttacacctggggtgaaaaggacccgttcgttaacggctactacctcacc
ggtgacatggtcatcaaccacggcaatggcaacttctccttcagtggccgggatgatgac
atcatcaccacggccggctaccgggtgggaccggcagacgtcgagagcacactgctcgag
cacgccgctgtggcggagtccggcgttgtcggcaagccggacgaaaagcgcggttccatc
atcaaggcttatgtggtgatcaagggcgattacgctcttggagacgaacaggccctgaaa
gacgaactgcaggagttggtgcgtcgcaggctctcgacccacgccttcccccgggagatt
gagtttgtcgatgagctgccgaagactcccagcggcaagatccagcggtttgtcctgcgt
aatcaggccaaggaagaaatcggcgcatga

DBGET integrated database retrieval system