KEGG   Marinobacter adhaerens: HP15_p187g60Help
Entry
HP15_p187g60      CDS       T01922                                 

Definition
asparagine synthase (EC:6.3.5.4)
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mad  Marinobacter adhaerens
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mad00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    HP15_p187g60
Enzymes [BR:mad01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     HP15_p187g60
Peptidases [BR:mad01002]
 Cysteine Peptidases
  Family C44
   HP15_p187g60
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
pHP-187:53811..55784
Genome map
AA seq 657 aa AA seqDB search
MCGITGIFGGVPGSEPLKSALKQMADAITHRGPDDSGTWEELSAGLGFGHRRLSIVDLSP
AGHQPMLSGCGRFVLAFNGEIYNHNALRRELESSGKVSAGWKGHSDTETLLCAFTAWGVE
KTLEMAAGMFAIALWDREEQSLTLARDRFGEKPLYYGLVAGALVFSSELKALQRAPRWRG
EVEPSVLESYLRFGCVGGQESIFKDVFKLPAGCLLKVSLLDIRHGEMPPVVRWWSPVEAA
GAALGGRNNNPDMALDNVEQALVASIRQQMAADVPLGAFLSGGVDSSLIGALMQSQTSQK
VRTFSVGFDDPRYDESEHAAAVAAYLGTEHTTLRATSKMALDLVPKLPELYDEPFADSSQ
LPTCLISALTRQHVTVALSGDAGDELFGGYNRYVWVPRVWSKLSRMPLPMRQTLGRMLKL
VPSSRYDRLMCLGRKVLPSRYQIRTFGEKLYKLADVLACSSDRALYGGLASMNRHPEQLL
RTDYRSGNPVEDLYPALAGFDPVEWMMLMDTLNFMVDDVLVKVDRSSMASSLEVRAPFLD
PEVFKAAWQLPLDMRVRNGEGKWALRQILYRHVPRELIERPKMGFAIPLDDWLRGPLREW
AEDLLGVRWLSQIPALDAKAVHLMWDRHIQGQGHYAQQLWAVLQLSAWVKHWNPSFG
NT seq 1974 nt NT seq  +upstreamnt  +downstreamnt
atgtgcgggattactggtattttcggtggtgttcctggtagcgaacctctcaagtctgcc
ctgaaacagatggccgatgctattacccatcgcggtccggacgattcgggtacttgggaa
gagctttcggctggtcttggtttcgggcatagacgtctttcgattgtggatttgtcgccc
gcaggccatcagccgatgctttccggttgtgggcgctttgtattggcatttaatggtgag
atatacaaccacaatgcgcttcgcagggaattagaatcttccggcaaggtatccgcaggc
tggaaaggacactcggacacagaaaccttgctttgtgcgttcactgcatggggtgttgag
aaaactctcgaaatggcagcaggtatgtttgccattgccctgtgggatcgagaagaacaa
tcgcttaccttggctcgggatcggtttggggagaagcctctctattatgggttggtggcg
ggtgccctggtgttcagttctgagctcaaagcgcttcagcgtgccccaagatggagggga
gaggtcgagcccagtgtgttagagagttacctccgctttggttgcgttggtgggcaggaa
agcattttcaaagatgttttcaagcttccggcaggctgtttactgaaagtttcgcttttg
gatatccgtcacggcgaaatgcctcctgtggtgcggtggtggtcgccagttgaggcggcg
ggggctgcgctgggggggcgcaataataatcctgatatggcgctggacaacgttgagcaa
gcgttggttgcctcgattcgccagcagatggcagcagatgtgccacttggggcatttctt
tccggaggtgtagacagttcgttgatcggcgcgttgatgcaaagccagaccagccagaag
gtgcgaaccttttcggttgggtttgatgaccctcgttacgatgaatctgagcatgcggct
gcggttgcggcgtaccttggaacggagcatacaactctccgggctacttcgaagatggca
ttggacctcgttcccaagcttccagaactgtacgatgagccgtttgccgattcgtcccaa
ttacctacctgcctgatatccgcgcttacccgccagcatgttacggttgccttgagtggc
gatgcgggtgatgagctgtttggtggctataaccgttatgtttgggttcccagagtttgg
agcaagttgagcagaatgcctctgccaatgcggcaaacgctagggcgcatgctgaaactg
gtgccttcgtctcgatacgatcgcttgatgtgcctaggtagaaaggttttgccctctagg
tatcagattcgtacctttggcgaaaagctctataagttagcagatgtgctcgcttgcagt
tcggaccgggctctttatggtggcctagcctcgatgaatcgtcaccctgaacagttatta
aggactgactatcgatctggaaatccggttgaggatttgtatcctgctttggcaggattt
gatccggtggaatggatgatgttgatggatacccttaacttcatggtggatgacgtgctg
gtgaaagtggatcgttccagtatggccagcagtcttgaagtcagggcgccattccttgat
ccagaggtatttaaagcagcttggcagttgccgttggatatgcgtgtgcgcaatggtgag
ggcaagtgggccttgcgccagattctctatcgccatgtgccccgggaactgattgaacgg
cccaagatggggtttgcgattcctttggatgactggttgcgtgggccgttgagggaatgg
gcggaagatttgcttggcgtgcggtggttgtctcagattccagctttagacgccaaagcg
gtgcacttgatgtgggatcggcacattcaggggcaaggacattatgcgcagcagttgtgg
gcagtgcttcagttgagtgcttgggttaagcactggaacccttcgtttggttaa

DBGET integrated database retrieval system