KEGG   Methanococcus aeolicus: Maeo_0043Help
Entry
Maeo_0043         CDS       T00552                                 

Definition
succinyl-CoA synthetase, beta subunit (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mae  Methanococcus aeolicus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:mae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Maeo_0043
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Maeo_0043
   00640 Propanoate metabolism
    Maeo_0043
   00660 C5-Branched dibasic acid metabolism
    Maeo_0043
Enzymes [BR:mae01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Maeo_0043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
47244..48326
Genome map
AA seq 360 aa AA seqDB search
MKLHEYEAKEIFKKYKIPVPNGFVASKPIKELKTPSVIKAQVLVGGRGKAGGILFADTTK
EANQHIKKLIGKKIKGEKVNKVLIEEKLPIKYEYYLGITIDRAEKKPVIIFSTEGGVDIE
EIAKNTPEKIIKYYIDPQNEFLPYMARNLLKEAGLPSNRISKVADIIYKLYNVFKDMDGT
LVEINPLVITKDKKVLAADGVLNVDDDAEYRHDYAQFESYSEKDKSEFAYVELDGDIAVI
GNGAGLTLASMDIVKEYGGAPACFLDIGGGSDKETVEKALEKALEKDIKGVFINILGGIT
RCDEVAMGIVKAYYEHPEIKFSVRMMGTNEEEGRKILTKNGIPFESSMEYAVEKLIDMLK
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacacgaatacgaagcaaaggaaatatttaaaaaatataaaatccccgttcca
aatgggtttgttgcatcaaaaccaattaaagagcttaaaacaccatctgtgataaaagct
caggttttagtaggtggaagaggtaaggccggaggaatattatttgcagataccacaaaa
gaggccaatcaacatataaaaaaattaattggtaaaaaaattaagggagaaaaagtaaat
aaagtattaatagaagaaaaattacctataaaatacgaatattatcttggaattacaatt
gacagggcagaaaaaaaacctgttataatattttctaccgaagggggcgtagatattgaa
gaaatagcaaaaaatacgcccgaaaaaataattaaatattatatagacccgcaaaatgaa
tttttaccatatatggcaagaaatctattaaaagaagcaggacttccatcaaacagaatt
tcaaaagttgcagacattatatataaattatacaatgtattcaaagacatggacggaacg
ctagttgagataaatcctttggtaattacaaaagataaaaaagtgcttgcagcagatggt
gttttaaatgtggatgatgatgcagaatataggcatgattatgcacaatttgagtcttac
tctgaaaaagataaatctgaatttgcatatgtggaattagatggagatattgctgtaatt
ggaaatggtgcaggtctaacacttgcaagtatggatattgtaaaagaatatgggggagct
cctgcatgtttccttgatataggtggcggttcagataaagaaactgttgaaaaagcactt
gaaaaagcacttgaaaaagatataaaaggagtatttattaatatattgggcggtattacc
cgatgtgatgaagtggcaatgggtattgtaaaagcatattatgaacacccagaaataaaa
ttctcagttagaatgatgggcactaatgaggaagaaggcagaaaaatattaactaaaaac
ggaattccatttgaatcttccatggagtatgccgttgaaaaattaatcgacatgctaaaa
taa

DBGET integrated database retrieval system