KEGG   Methanococcus aeolicus: Maeo_0043Help
Entry
Maeo_0043         CDS       T00552                                 

Definition
succinyl-CoA synthetase, beta subunit (EC:6.2.1.5)
Orthology
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
mae  Methanococcus aeolicus
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Carbon fixation pathways in prokaryotes
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Maeo_0043
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Maeo_0043
   00640 Propanoate metabolism
    Maeo_0043
   00660 C5-Branched dibasic acid metabolism
    Maeo_0043
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Maeo_0043
Enzymes [BR:mae01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Maeo_0043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
47244..48326
Genome map
AA seq 360 aa AA seqDB search
MKLHEYEAKEIFKKYKIPVPNGFVASKPIKELKTPSVIKAQVLVGGRGKAGGILFADTTK
EANQHIKKLIGKKIKGEKVNKVLIEEKLPIKYEYYLGITIDRAEKKPVIIFSTEGGVDIE
EIAKNTPEKIIKYYIDPQNEFLPYMARNLLKEAGLPSNRISKVADIIYKLYNVFKDMDGT
LVEINPLVITKDKKVLAADGVLNVDDDAEYRHDYAQFESYSEKDKSEFAYVELDGDIAVI
GNGAGLTLASMDIVKEYGGAPACFLDIGGGSDKETVEKALEKALEKDIKGVFINILGGIT
RCDEVAMGIVKAYYEHPEIKFSVRMMGTNEEEGRKILTKNGIPFESSMEYAVEKLIDMLK
NT seq 1083 nt NT seq  +upstreamnt  +downstreamnt
atgaaattacacgaatacgaagcaaaggaaatatttaaaaaatataaaatccccgttcca
aatgggtttgttgcatcaaaaccaattaaagagcttaaaacaccatctgtgataaaagct
caggttttagtaggtggaagaggtaaggccggaggaatattatttgcagataccacaaaa
gaggccaatcaacatataaaaaaattaattggtaaaaaaattaagggagaaaaagtaaat
aaagtattaatagaagaaaaattacctataaaatacgaatattatcttggaattacaatt
gacagggcagaaaaaaaacctgttataatattttctaccgaagggggcgtagatattgaa
gaaatagcaaaaaatacgcccgaaaaaataattaaatattatatagacccgcaaaatgaa
tttttaccatatatggcaagaaatctattaaaagaagcaggacttccatcaaacagaatt
tcaaaagttgcagacattatatataaattatacaatgtattcaaagacatggacggaacg
ctagttgagataaatcctttggtaattacaaaagataaaaaagtgcttgcagcagatggt
gttttaaatgtggatgatgatgcagaatataggcatgattatgcacaatttgagtcttac
tctgaaaaagataaatctgaatttgcatatgtggaattagatggagatattgctgtaatt
ggaaatggtgcaggtctaacacttgcaagtatggatattgtaaaagaatatgggggagct
cctgcatgtttccttgatataggtggcggttcagataaagaaactgttgaaaaagcactt
gaaaaagcacttgaaaaagatataaaaggagtatttattaatatattgggcggtattacc
cgatgtgatgaagtggcaatgggtattgtaaaagcatattatgaacacccagaaataaaa
ttctcagttagaatgatgggcactaatgaggaagaaggcagaaaaatattaactaaaaac
ggaattccatttgaatcttccatggagtatgccgttgaaaaattaatcgacatgctaaaa
taa

DBGET integrated database retrieval system