KEGG   Methanococcus aeolicus: Maeo_0107Help
Entry
Maeo_0107         CDS       T00552                                 

Definition
magnesium chelatase
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
mae  Methanococcus aeolicus
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mae00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Maeo_0107
Enzymes [BR:mae01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Maeo_0107
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(114125..114661)
Genome map
AA seq 178 aa AA seqDB search
MGAMKRMEVSKGAISSLLMDAYQKRNKIGMISFRKEEAELILPFTSSVELGEKLLRNLPT
GGKTPLSKAFFNSYEAIKNEIRKNPNIIPIALFISDFKPNVAMKDDYIKEVFDICEKFAE
DEITVILVDTEPKSFIKIGIGENLAKKYGFEYYKIDDLNVGDIVGIVNNLAIGGNIDR
NT seq 537 nt NT seq  +upstreamnt  +downstreamnt
atgggggcaatgaaaagaatggaagtttctaagggggcaatttcatctttattaatggat
gcatatcaaaaaagaaataaaattggaatgatttcatttagaaaagaagaagctgagctt
attcttccatttacttcatcggttgaattgggagaaaaactactaagaaatttaccgacg
ggcgggaaaacaccactttcaaaggcattttttaactcttatgaagcaattaaaaatgag
ataagaaaaaatccaaatattattccaatagccctatttataagtgattttaagccaaat
gttgctatgaaagacgattatataaaagaagtttttgatatttgcgaaaagttcgcagaa
gatgaaataaccgttatattggtggatactgaaccaaaatcatttataaaaataggaatt
ggggaaaatcttgctaaaaaatatggtttcgaatattataaaatagacgatttaaatgtg
ggtgatattgttggaatagtaaataatttggcgataggtggtaatattgatagataa

DBGET integrated database retrieval system