KEGG   Methanococcus aeolicus: Maeo_0108Help
Entry
Maeo_0108         CDS       T00552                                 

Definition
(GenBank) Magnesium chelatase
  KO
K03405  magnesium chelatase subunit I [EC:6.6.1.1]
Organism
mae  Methanococcus aeolicus
Pathway
mae00860  Porphyrin and chlorophyll metabolism
mae01100  Metabolic pathways
mae01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mae00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Maeo_0108
Enzymes [BR:mae01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Maeo_0108
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_5 Mg_chelatase MCM AAA_16 AAA_3 AAA_22 DUF3837 AAA
Motif
Other DBs
NCBI-ProteinID: ABR55700
JGI: Maeo0108
UniProt: A6UT78
Position
complement(115171..116241)
Genome map
AA seq 356 aa AA seqDB search
MTMVFPFTAIVGQQKMKKALILNAINPKIGGVLIRGEKGTAKSTAVRALAELLPEIEIVK
GCSFNCNPYGDMCDICKDKRKNGMLKTIKRKMKVVDLPIGSTEDRVIGTLDIEKAIKEGV
KALESGILADANRNILYIDEINLLDDHIIDILLDAAAMGWNTIEREGINIKHPSKFILVG
TMNPEEGELRPQILDRFGLMVDVEGLDDVKQRVEVIKMVEEFNKNPEEVYKQSEEENINL
REKIENARKNLDSVNISDDLLELISKICIELNIPTNRADITVARTAKTIASFNSKDYVSI
EDIKEACDLALPHRMRRKPFEPPQLNNEKIEEMINNFENEENEKEQNDKENDLKKN
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atgacaatggtatttccatttacggcaatagtaggacagcaaaaaatgaaaaaggcacta
attttgaatgctattaatccaaaaataggcggagtattgattagaggagaaaagggaaca
gcaaaatccacagcagttagggcattggcggagctcctacctgaaattgaaattgtaaaa
ggatgttcatttaactgtaatccatatggagatatgtgcgatatatgtaaagataaacgg
aaaaatggaatgctaaaaacaattaaaagaaaaatgaaagttgtagatttaccaatagga
agcacagaggatagagtaattggaacgcttgacatagaaaaagccattaaagaaggagta
aaggcactggaatcaggaatattggcagatgccaatagaaatatactgtatatagacgaa
ataaatttattagatgaccatattatagatattcttttagatgcggcggccatgggttgg
aatactattgaaagagagggaataaatatcaaacatccatctaaatttatactggttgga
acaatgaacccagaagagggagaattaagacctcaaatattggatagatttggtttaatg
gttgatgtagagggattagatgatgttaaacaaagggttgaagttataaaaatggttgaa
gaatttaacaaaaatccagaggaagtttataaacaaagtgaagaagaaaatattaattta
agggaaaaaatagaaaatgcgagaaaaaatttagacagtgtaaatattagtgatgattta
ttggaattaatttcaaaaatttgtattgagttaaatattcctacaaatagggcagatatt
actgtggcaaggactgcaaaaaccatagcctcatttaacagcaaggattatgttagtatc
gaggatattaaagaggcatgtgatttagcactaccccatagaatgagaagaaagcctttt
gagcctccacaattaaataatgaaaaaatagaggaaatgataaataattttgaaaatgag
gaaaatgaaaaagaacaaaatgataaggagaatgatttaaaaaaaaactaa

DBGET integrated database retrieval system