KEGG   Methanococcus aeolicus: Maeo_0171Help
Entry
Maeo_0171         CDS       T00552                                 

Definition
hypothetical protein
Orthology
K01622  
fructose 1,6-bisphosphate aldolase/phosphatase [EC:4.1.2.13 3.1.3.11]
Organism
mae  Methanococcus aeolicus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Maeo_0171
   01230 Biosynthesis of amino acids
    Maeo_0171
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Maeo_0171
   00030 Pentose phosphate pathway
    Maeo_0171
   00051 Fructose and mannose metabolism
    Maeo_0171
  Energy metabolism
   00680 Methane metabolism
    Maeo_0171
Enzymes [BR:mae01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     Maeo_0171
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Maeo_0171
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
189172..190323
Genome map
AA seq 383 aa AA seqDB search
MNGEKITLSVIKADVGGLCGHTSAPEELMDACEFVLEEALDELIIDYYVTKCGDDVDLIM
THQKGTDNKEIHGLAWSAFEEATEVAKELKLYGAGQDLLSEGFTGNVKGMGPGCAEMEFV
ERPSEPVIVFCSDKTDPAAFNLPFYRMFADPFNTPGLVYDKKMQTGFDFDVLDIYQNKKI
LLNTPKETYQLLALIGNLETYSVKSVYRARDGEIAATCSADKLSKVGGKYVGKDDPVAIV
RPQSGMPSVGEILEAFAKPHMVPGWMRGCHWGPLMPVGEDDANPTRFDGPPRIFALGFQL
SKGRLVGPNDFFADVGFDSARKKALEMADMIREMGPFQPHRLSESMMEYSSIKKVLADLE
DRFVPNEKHEVVDKLTYDVEDQS
NT seq 1152 nt NT seq  +upstreamnt  +downstreamnt
atgaacggagaaaaaataactttaagtgttataaaagctgatgtaggaggattatgtggt
catacctcggcacctgaggaattaatggacgcatgtgaattcgtgcttgaagaagccctt
gatgagttaataattgattactatgtcaccaaatgtggagacgatgtagatttaatcatg
acccaccaaaaaggaacagataataaggaaatacatgggttggcatggagtgcatttgag
gaagccacagaagtggcaaaagaattaaaattatatggtgccggtcaagatttactttcc
gaaggtttcactggaaatgtaaaaggaatgggtccgggctgtgctgaaatggaatttgtt
gaaagaccaagcgaacctgttatagtattttgtagtgataaaacagaccccgcagcgttt
aaccttccattttataggatgtttgcagacccatttaatacgccaggattagtttatgac
aaaaaaatgcaaactggatttgattttgatgtattggacatatatcaaaacaaaaaaata
ttgttaaatactccaaaagaaacatatcaattattggcattaattggaaatttggaaact
tattctgtaaaaagtgtttatagagcaagagatggggaaattgccgcaacatgcagtgca
gataaattaagtaaagttggaggaaaatatgttggtaaagatgaccctgtggcaatagtg
agacctcaaagcggtatgccatcagtaggggaaatattggaagcatttgctaaaccacac
atggttccaggatggatgagaggatgccactggggaccattgatgcctgttggtgaggac
gatgctaacccaacaagatttgatggacctccaagaattttcgcattaggattccagctt
tcaaaaggtagattggtgggaccaaatgatttctttgcagatgttggatttgatagtgca
aggaaaaaagcattagaaatggcagatatgattagagaaatggggccattccagcctcac
agattatctgagtctatgatggaatatagttcaattaaaaaagtattggccgatttagag
gatagatttgtgccaaatgaaaaacatgaagtcgtagataaattaacctatgatgtagaa
gaccaaagttaa

DBGET integrated database retrieval system