KEGG   Methanococcus aeolicus: Maeo_0198Help
Entry
Maeo_0198         CDS       T00552                                 

Definition
class II aldolase/adducin family protein
Orthology
K01628  
L-fuculose-phosphate aldolase [EC:4.1.2.17]
Organism
mae  Methanococcus aeolicus
Pathway
Fructose and mannose metabolism
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:mae00001]
 Metabolism
  Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    Maeo_0198
Enzymes [BR:mae01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.17  L-fuculose-phosphate aldolase
     Maeo_0198
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
213351..213893
Genome map
AA seq 180 aa AA seqDB search
MDNLKEFIKICHYLYDRKYVVGSGGNVSIKKDNLIYVTPTDSLLGFINEEDIAVVDMDGN
IIKGAPTSELYMHLNIYKKRNGVNAIVHTHSLYSTALPMADKEIKLLTPESRIFLKKIGY
VDYFEARSMELANEVSKKDEDVIVLKNHGIVCVGKNLMDAYLKTEVMEEISQLNYIIHSL
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggataatttaaaagagtttataaaaatatgtcattatttgtatgatagaaaatatgtt
gttggaagcgggggaaatgtaagtataaaaaaagataatttgatatatgttactcccaca
gattctttactgggatttataaatgaggaggatatagcagttgtagatatggatggaaat
attattaagggagctcccacatcagaactatatatgcatctaaatatatataaaaaaaga
aatggcgtaaatgccatagttcatactcattctttgtattctacggcactacccatggca
gataaagaaataaaattattaacccctgaatctagaatattcttaaagaaaattggatat
gtagattattttgaagctagaagcatggaattagctaacgaagtttctaaaaaagacgaa
gatgttattgttttaaaaaatcatggaattgtatgtgttggaaaaaatttaatggatgca
tatttaaaaacagaagttatggaggaaatttcccaattgaattatattattcattcttta
tag

DBGET integrated database retrieval system