KEGG   Methanococcus aeolicus: Maeo_0205Help
Entry
Maeo_0205         CDS       T00552                                 

Definition
asparagine synthase
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
mae  Methanococcus aeolicus
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:mae00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(218553..220145)
Genome map
AA seq 530 aa AA seqDB search
MCSINGIILKDDEEEPSSCSNDYNYNDIQLPKQLIKGMKILKHRGPDSSGLMFDDEVIYF
NDFNELKELNTSQKNNRLGIGHNRLAIVGEANQPIPNENENLWTICNGEIYNYNELKEDL
SSHDIYSDTDTEIILHAYEEDIFDELDGDYAYCIYDKDENKIILGRDLFGVKPLYYIDNK
KYFAFASEKKALINLLMDINNLSFEDAYNYNISNLKPNSCIVYDLNDNELTKWENIRKIT
TNYFNKYKNMDYDVCKEELEEALWSSVSKRVNGIDEIGIIYSGGVDSTLIAKMASEYGEV
ILYVVGIDEKSDDIIWAEKAANDMGLKLRKKIINPKDYENYLLKVAYAIDEIDLMKMAVG
IPMFVASEMAKEDGIKVVLSGQGADELFGGYNRYKRIFDENGANGLKEALYNDVMDIYKV
NLERDDHCTMANGVELRVPFLDKNVVELGLSIPIEYKLNEKERKIILRDIALKYIPEYIA
YRPKKAAQYGSGSEKIIFKVAKNYGYSKKEINKFFDEILFKKLKGMYINK
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
atgtgttcgataaatggaattatattaaaagacgacgaggaagagccgagtagttgtagc
aatgattataattataatgatatacaattaccaaaacaattaataaaaggaatgaaaatt
ttgaaacataggggtccagatagttctggcttgatgtttgatgatgaggtaatttatttt
aatgattttaatgaattgaaagagttaaacacaagccaaaaaaataataggttaggtatt
ggacacaatagacttgcaatagtgggagaagctaaccagccaatacctaatgaaaatgaa
aatttatggactatttgcaacggggaaatatataactacaacgaattaaaagaagattta
agtagtcatgacatatattcagatacggacacagagataatattacatgcctatgaagag
gacatatttgatgaattagatggggattatgcctactgcatatacgataaggacgaaaat
aaaataatacttggtagggatttatttggagtaaagccactttattatattgataataaa
aaatattttgcatttgcatcggaaaaaaaggcactaattaatttattgatggacataaat
aatctatcttttgaagatgcatacaattacaacatatcaaatttaaaaccaaatagttgt
atagtttatgatttaaatgacaatgagcttacaaaatgggaaaatattagaaagattact
acaaattatttcaataaatataaaaatatggattatgatgtctgtaaagaagaacttgaa
gaggcactatggagctccgtgtcaaaacgagttaatggaattgatgaaattggaataatt
tattcagggggagtagatagcacacttatagcaaaaatggcatcagaatacggagaagta
atattgtatgtagtgggaattgatgaaaaaagcgatgacataatatgggctgaaaaagct
gcaaatgatatggggctaaaattaagaaaaaaaataataaaccccaaagattatgaaaac
tatcttttaaaagttgcctatgccattgatgaaattgatttaatgaaaatggctgttggt
atccctatgtttgtagcttcggaaatggcaaaagaggacggcataaaagttgtattatct
ggacaaggtgcagacgaattatttgggggatacaatagatataaaagaatatttgatgaa
aacggggcaaatggattaaaagaggcattatataatgatgtaatggatatatataaagtc
aatttggagagagatgaccactgcacaatggcaaatggtgtggagctccgtgttccattt
ttagataaaaatgttgttgagctaggattatcaattcctatcgaatataaattaaatgaa
aaagagagaaaaataattttaagagatatagctttaaaatatattcccgaatatatcgcc
tatcgtccaaaaaaagctgcccaatatggtagtggaagcgaaaaaataatatttaaagtt
gctaaaaattatggatattctaaaaaagaaattaataaattctttgacgaaatattattt
aagaaattaaaggggatgtatattaataaataa

DBGET integrated database retrieval system