KEGG   Methanococcus aeolicus: Maeo_0279Help
Entry
Maeo_0279         CDS       T00552                                 

Definition
ELP3 family histone acetyltransferase (EC:2.3.1.48)
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
mae  Methanococcus aeolicus
Brite
Enzymes [BR:mae01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     Maeo_0279
Transfer RNA biogenesis [BR:mae03016]
 Eukaryotic Type
  tRNA modification factors
   Elongator complex
    Maeo_0279
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(303845..305536)
Genome map
AA seq 563 aa AA seqDB search
MNIKNTKSKILNKNTENHNENYEKSYKEFILYIIKKLMENSKDINNLPPKKKKQKIEDIK
ARGLRKYKLNIGFPPNSEIIKYATEEEKKIIVPILRKKPIRTLSGVAVVAIMTSPHECPH
GKCFFCPGGTDSNFGEVPQSYTGKEPATMRGIMYDFDPYIQTKERIEQLEKVGHPTDKVE
IIIMGGTFPSRPPEYQDNFVKGCLDALNGTISDTLEEAQKINETAKHRCVALTVETRPDY
CTEKEINQMLKLGATKVEIGVQTIYNDILNHIKRGHGVEDTIKATQLLRDSGLKISYHIM
PGLPMSSKELDKKLFYEIFNNPNFKPDLIKIYPCLVIKGTELYDIYERGEFKPINDNDAI
ELITYAKSIMPKWVRTSRIQRDIPATVIEEGVRKSNLGELIYKNLEAQNIKCKCIRCREV
GHIIYKKGIIPKLEDIKLCREDYEANGGTEIFLSYEDTKNDILIGYLRLRIPYKPFRPEI
DNNTALIRQLHICGQGQKLTETEDKETTWQHKGYGKLLLKEAEKIAKEEFNKNKILINSG
IGVREYYKKIGYERIGAYMGKNL
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
atgaatattaaaaatacaaaatcaaagattttgaataaaaatactgaaaatcataatgaa
aactatgaaaaaagctataaagaatttatattatatataattaaaaaactaatggaaaat
agcaaagatataaacaatttacctccaaaaaagaaaaaacaaaagatagaagatataaaa
gctcgaggtttaaggaaatataaattaaatataggatttcctccaaattcagaaataata
aaatatgccacggaggaggagaaaaaaataatagtcccaatattgagaaaaaaacctatt
agaacactttcgggtgtggctgttgtggcaattatgacctcccctcatgagtgcccacat
ggaaaatgttttttctgtccagggggaacagacagcaattttggagaagtaccccaaagc
tacacaggaaaagaaccagccacaatgcgaggaattatgtatgattttgacccatatatt
caaacaaaggaaagaatagaacagcttgaaaaagttggacatccaaccgataaagtagaa
ataattataatgggggggacatttccatctaggccaccagaatatcaggacaactttgtt
aaaggctgtttagatgctttaaatggaacaatatccgatacacttgaagaagcacagaag
ataaacgaaactgcaaaacatagatgcgtggcacttactgtggagactagacctgactac
tgcacagaaaaagaaataaaccaaatgctaaaattgggagctacaaaagtagaaattgga
gttcaaaccatatacaacgacatattaaatcatataaaaagaggacatggtgtagaagat
actataaaagcaacccaattattaagagatagtggtttaaaaatatcttaccatattatg
ccggggcttccaatgtcttcaaaagaattggataaaaaattattctacgaaatatttaac
aatccgaactttaaaccagatttaataaaaatatacccctgtcttgtaataaaaggaact
gaattatatgacatatatgaaagaggagaatttaaaccaataaatgataatgatgcaata
gaattaattacctacgcaaaatcaataatgccaaaatgggttagaacctcacgaatacag
cgagatatacctgcaacggtaattgaggaaggagttcggaaaagtaatttgggggagctc
atatataaaaatttagaggctcaaaatataaaatgtaaatgtataagatgtagggaagtt
ggacatataatatataaaaaaggaataataccaaaattagaagatataaaactttgtagg
gaagactatgaagcaaatggtggaacagagatatttttatcgtatgaagacaccaaaaat
gatatattaataggctaccttagattaagaattccatataaaccatttagaccagagata
gataacaacacggcattaataagacagctccatatatgcggacaggggcaaaaattaacc
gaaacagaggacaaagaaacaacatggcaacataaaggatatggaaaattattattaaaa
gaggctgaaaaaatagcaaaagaagaatttaataaaaataaaatattaataaatagcggt
attggagttagagaatattataaaaagataggttatgaaagaattggggcatatatggga
aaaaatttataa

DBGET integrated database retrieval system