KEGG   Methanococcus aeolicus: Maeo_0346Help
Entry
Maeo_0346         CDS       T00552                                 

Definition
(RefSeq) threonine synthase (EC:4.2.3.1)
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
mae  Methanococcus aeolicus
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:mae00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Maeo_0346
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Maeo_0346
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Maeo_0346
Enzymes [BR:mae01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Maeo_0346
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
367669..368883
Genome map
AA seq 404 aa AA seqDB search
MIQKCIVCGKEYDIDEIIYTCECGSLLEIIYDYEAIKENISKEELRKRRIGVWRYLEYLP
VKDPKKIVSLWEGGTPLYKCDNLAKKLGLKELYVKNEGANPTGSFKDRGMTMGTTRANEL
GVEIIGCASTGNTSASLAAYTAKSNKKCIVLLPSGNVALGKLAQAMFYGAKVIQINGNFD
DAMDMVKELALQGKIYLLNSINPFRLEGQKTIGFEICDQLDWEVPDRVILPVGNAGNISA
IWKGFKEFKETGIIDKLPKMTGIQAEGAKPIVEAFKKGVKEIIPEEHPETIATAIRIGNP
VNYTKAMDAIYSSNGFADSVNDEEITKAQKLLAQTEGIFVEPASAASIAGLIKLIETGVI
DKNEKIVCITTGNGLKDPDAAIRVSDKPIEIECDMDILNDVINE
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgattcaaaaatgtatcgtttgtggaaaggaatatgatattgacgaaattatatatact
tgcgaatgtggctcattgttggagataatctatgattatgaggcaataaaagaaaatata
tcaaaagaggagctccggaaaagaagaataggagtatggagatatttagaatatttgcca
gtgaaagaccctaaaaagattgtatcgctatgggaaggtggaactccattatataaatgt
gataatcttgcaaaaaaattaggattaaaggagttatatgttaaaaatgaaggagctaac
ccaacaggaagtttcaaagacagaggtatgacaatgggaacaacacgagcaaatgagctt
ggagttgaaataataggttgtgcatctactggaaatacttcggcatcattggcagcatat
acagcaaaatctaataaaaagtgcattgtattattacctagtggaaatgttgcacttgga
aaacttgctcaggctatgttttatggtgcaaaagttatacaaatcaatggaaactttgat
gatgctatggatatggttaaagaattggcattacaaggtaaaatatatttattaaattca
ataaatccatttagattggaaggtcaaaaaaccattggatttgagatttgcgaccagttg
gattgggaagttccagatagagtaatacttccagttggaaatgcgggaaatataagtgca
atatggaaaggatttaaagaatttaaagaaacagggataatagataaattaccaaaaatg
acaggaattcaagcggaaggagctaaaccaatcgtagaagcatttaagaaaggagtaaaa
gaaataattccagaagagcacccagaaacaatagctacggcaattagaatcggaaatcct
gtaaattatacaaaagcaatggatgcaatatactcctcgaatggatttgctgattcagtg
aatgatgaggaaataacaaaagctcaaaaattgcttgctcaaacagaaggaatatttgta
gagcctgcatcagcggcatcaatagcaggacttataaaattaatagaaacaggcgttatt
gacaaaaatgaaaaaattgtatgtatcaccacaggaaatggattaaaagacccagatgca
gcaataagggtaagcgataaacctattgaaattgaatgtgatatggacatattaaatgat
gtaattaatgaataa

DBGET integrated database retrieval system