KEGG   Methanococcus aeolicus: Maeo_0377Help
Entry
Maeo_0377         CDS       T00552                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
mae  Methanococcus aeolicus
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:mae00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Maeo_0377
   00052 Galactose metabolism
    Maeo_0377
   00500 Starch and sucrose metabolism
    Maeo_0377
   00520 Amino sugar and nucleotide sugar metabolism
    Maeo_0377
Enzymes [BR:mae01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Maeo_0377
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
390082..390939
Genome map
AA seq 285 aa AA seqDB search
MEKMIKKAVIPAAGFGTRLLPLTKAKPKEMLSVVDKPIIQYVIEDLADASVDNILIVTGK
GKSAIENHFDRNYGLENKLKEGGKTELLNIIGKIDNLANIFYTRQKQQKGLGDAIYCGKE
FVGKEYFLALVGDTIYTGNVVQKMLEVYEKYRCSVIVLERVPKELVYKYGVISGKEIEEG
IFELDDLVEKPSVEGAPSNLIITGAYLLSPKIFDHLETIEIGAGGELQLTDAMKSLLKEE
KIMGVEVDCTRYDIGDIEGWLKANVEIAMEKIPNFKDYLKEVVNK
NT seq 858 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaaatgataaaaaaagcagttataccggcggcgggatttggaacaagattattg
cccctaacaaaggcaaaaccaaaagagatgttatcagtagtggataaacccataattcaa
tatgtaattgaagatttggctgatgcaagcgttgataatatattaatagttacaggaaag
ggaaaaagtgcaatagaaaatcattttgatagaaattatgggcttgaaaataaattaaaa
gaaggcgggaaaacagaattattaaatattattggtaaaatagataatttggcaaatata
ttttataccagacaaaaacaacaaaaaggactgggggatgccatatactgcggaaaagaa
tttgtcggaaaagaatattttttagcacttgttggagatacaatatatactggcaatgta
gttcaaaaaatgcttgaagtgtatgaaaaatacagatgttccgtaattgttcttgaaaga
gtgccaaaagaattagtttataaatatggggtaatttctggaaaagaaattgaggaggga
atatttgaattagatgatttagttgaaaaaccatctgttgagggagctccctcaaattta
ataatcacgggggcatatttattatcgccaaaaatatttgaccatttggaaaccattgaa
attggtgctggaggggagctccaattaaccgatgcaatgaaatcattattaaaagaggaa
aaaataatgggtgttgaggtggattgcacccgatatgatataggagatattgagggatgg
ttaaaggcaaatgttgaaattgccatggaaaaaattcccaattttaaggattatttaaaa
gaagttgttaataaataa

DBGET integrated database retrieval system