KEGG   Methanococcus aeolicus: Maeo_0444Help
Entry
Maeo_0444         CDS       T00552                                 

Definition
(GenBank) Aldehyde ferredoxin oxidoreductase
  KO
K11389  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin) [EC:1.2.7.6]
Organism
mae  Methanococcus aeolicus
Pathway
mae00010  Glycolysis / Gluconeogenesis
mae01100  Metabolic pathways
mae01120  Microbial metabolism in diverse environments
mae01200  Carbon metabolism
mae01230  Biosynthesis of amino acids
Module
mae_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
mae_M00002  Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:mae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Maeo_0444
Enzymes [BR:mae01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.6  glyceraldehyde-3-phosphate dehydrogenase (ferredoxin)
     Maeo_0444
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AFOR_N AFOR_C DUF4476
Motif
Other DBs
NCBI-ProteinID: ABR56030
JGI: Maeo0444
UniProt: A6UU58
Position
complement(465057..466961)
Genome map
AA seq 634 aa AA seqDB search
MNIIINVSEKNYENIDGTYFPLNWGMELHKKYKTYELHPYDENNVFCFGRGVLPIIGGNR
LIFSFKSPLWESFHFSAMGGAGYQFKDTGLKNVGIIGKCEKPSLLVINGENNAIEIDYID
MEDYVKNYTNIYDLNNYILDKFKDKNYRALIVGPSSINSNMGAVLSQTVRNGKFVEGSED
WAARGGIGSALYRAHNILGVVYCGDKNNSSNKEEKELKSKLKAIVEEYYEKPLTKVIIEG
TKKYRFDKEINTGGTFGCNYVSLKDKAPMFNWKMIYMGKEERTELHKRLLTYFVGKFNEE
STNPKKWTNCGEPCPVLCKKYRLDGLKVDYEPYSANGPQIGVFDIHATDKVVHRIDAMGY
DAIEMGELLSWVFELLDIGLLKPEEVGINKPKFSPSDFKTEEDMLNNSNYNSSQAVELVN
IIAFEKNEIGKILALGKRKASQIFNDKFKDRLKEGEKFEDYAVYVPFGKSGEMAPTLYWA
IGNFMPYLIQGKYLTHYKYGVFFEPEKLSQLSVARTLEEATLENLGICRFHRVWINPVIK
DLVNEIMGIDFDLEENTRNLIKDIYEYNKKICPNPHKIESNRVKDIIALGAEEFGDEKWS
KLFKEDRDKYIDEYVKRAMSEYSKLLDIDWNIKD
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
ttgaatattataataaatgtttcagaaaaaaattatgaaaatatagatgggacatatttt
ccattaaattggggcatggagctccacaaaaaatacaaaacatatgaactacatccatac
gacgaaaacaatgttttttgtttcggcagaggggttcttccaataattgggggcaataga
ctaatattttcatttaaatctccattgtgggaatcatttcatttttcagcaatgggcgga
gcaggatatcaatttaaagatacaggattaaaaaatgtgggcataattggaaaatgtgaa
aaaccaagtttattggtaataaatggggaaaataatgccatagaaatagattatattgat
atggaggattatgtaaaaaactatacaaatatttacgatttaaataactacatattggac
aaattcaaagataaaaattatagggcattaattgtaggtccgtcctcaattaactcaaat
atgggtgcagtattatctcaaacagtgagaaacggaaaatttgttgaaggttctgaggac
tgggcagcaagaggcggtataggttctgcattatatcgagcacataacatattaggggtt
gtatattgtggggataaaaataattcatcaaataaagaagaaaaagagctaaaaagtaaa
ttaaaggcaatagtggaagaatattatgaaaagccactcacaaaggtaataatcgaaggc
actaaaaaatatcgatttgataaagaaataaacacaggggggacttttggctgtaattat
gtatcattaaaggataaagcaccaatgtttaattggaaaatgatttatatgggcaaagaa
gaaagaaccgaattacataaaagattattaacatattttgtcggaaaattcaacgaagaa
tcaacaaatcctaaaaaatggacaaattgcggggagccatgtcctgtattatgtaaaaaa
tataggttagatggtttaaaagtggattatgaaccatatagtgcaaatggtccccaaata
ggggtatttgatatacatgccacagataaagttgtgcatcgtatagatgctatggggtat
gatgccattgaaatgggggagctcctctcatgggtatttgagttattggatattgggcta
ttaaaaccagaggaagttggaataaacaagcccaaatttagcccttcggattttaaaact
gaggaagatatgctaaataattcaaactacaacagttcccaggctgtggaattagtaaat
ataatagcatttgaaaaaaatgaaataggaaaaatacttgcattgggtaaaagaaaggca
tctcaaatatttaacgataaatttaaagataggttaaaagaaggggaaaaattcgaagat
tatgccgtttatgtcccatttggaaaaagtggggaaatggctccaacgctgtattgggct
attggtaattttatgccctatcttattcaaggaaaatatttaacccattataaatatgga
gtattttttgaacctgaaaaattatctcaattaagtgttgcaagaactttggaggaggca
acccttgaaaatttaggtatttgtagattccatagagtatggataaatccagtaattaaa
gatttagtaaatgaaattatgggtattgattttgatttagaggaaaatactcgaaattta
attaaagatatatatgaatacaataaaaaaatatgtccaaatcctcataaaatagaaagt
aatagagttaaagacataatagcacttggtgcggaagaatttggagacgaaaaatggagt
aaattgtttaaagaagatagggataaatatattgacgaatatgtaaaaagagcaatgagt
gaatatagtaaattattagatatagattggaatattaaagattaa

DBGET integrated database retrieval system