KEGG   Methanococcus aeolicus: Maeo_0465Help
Entry
Maeo_0465         CDS       T00552                                 

Definition
(GenBank) thiamine pyrophosphate protein domain protein TPP-binding
  KO
K00170  pyruvate ferredoxin oxidoreductase beta subunit [EC:1.2.7.1]
Organism
mae  Methanococcus aeolicus
Pathway
mae00010  Glycolysis / Gluconeogenesis
mae00020  Citrate cycle (TCA cycle)
mae00620  Pyruvate metabolism
mae00633  Nitrotoluene degradation
mae00640  Propanoate metabolism
mae00650  Butanoate metabolism
mae00680  Methane metabolism
mae00720  Carbon fixation pathways in prokaryotes
mae01100  Metabolic pathways
mae01120  Microbial metabolism in diverse environments
mae01130  Biosynthesis of antibiotics
mae01200  Carbon metabolism
Module
mae_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
mae_M00620  Incomplete reductive citrate cycle, acetyl-CoA => oxoglutarate
Brite
KEGG Orthology (KO) [BR:mae00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Maeo_0465
   00020 Citrate cycle (TCA cycle)
    Maeo_0465
   00620 Pyruvate metabolism
    Maeo_0465
   00640 Propanoate metabolism
    Maeo_0465
   00650 Butanoate metabolism
    Maeo_0465
  Energy metabolism
   00720 Carbon fixation pathways in prokaryotes
    Maeo_0465
   00680 Methane metabolism
    Maeo_0465
  Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Maeo_0465
Enzymes [BR:mae01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Maeo_0465
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_C DXP_synthase_N HARP E1_dh
Motif
Other DBs
NCBI-ProteinID: ABR56051
JGI: Maeo0465
UniProt: A6UU79
Position
485869..486762
Genome map
AA seq 297 aa AA seqDB search
MKITDIPKEEYLAPGARACAGCPELLALRLALKICGEDTIVVAPTGCMEVITTIYPETAW
RVPFIHVAFENAAAVASGIENAMKRKGKKTNIVVFAGDGATADIGFQSLSGAIEREHNIL
YICTDNEAYANTGKQRSGTTPYGASTTTSPAGKYSIGKPEEKKNMPFIVAAHGAPYIATA
SIGYPFDFLKKVKKALSIKGFKYLHVHAPCPTGWGFHSKDGIKIAKLAVQSGLWTLYEIE
NKKFKMNYKNKKIPVKDYLNIQKRFKHLSDIEIEHIQKRTDTSWEELLEHNNKKILI
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcacagatattccaaaagaagaatatttagcaccaggagcaagagcctgtgct
ggatgcccagaacttcttgctttaaggttggctttaaaaatatgtggagaagacacaatt
gttgttgcacctactggatgtatggaagttattactacaatatatcctgaaactgcctgg
cgagtgccatttatacatgttgcatttgaaaatgccgctgctgttgcaagtggcatagaa
aatgccatgaaaagaaagggtaaaaagacaaatattgtagtatttgcaggagatggagct
accgcagatattggttttcaatcattatcgggagccatagagcgagagcataatatatta
tacatatgcacagataatgaggcatatgcaaatactggaaaacagagaagtggaaccaca
ccttatggggcatcaacaactaccagtcctgctggaaaatacagtattggaaagccagaa
gaaaaaaagaatatgccttttatcgtggctgcccatggagctccctatattgctactgca
tcaataggctacccatttgactttctaaaaaaagtgaaaaaggcattatcaattaaggga
tttaaatatctccatgtccatgccccatgccctactggatggggatttcatagtaaagat
ggaataaaaattgcaaaattagctgttcaatctggattatggacactttatgaaattgaa
aataaaaaatttaagatgaactataaaaacaaaaaaatacctgtgaaggattatttaaat
attcagaaaagatttaaacacctttcagacattgaaattgagcatatacagaaaagaaca
gatactagctgggaggaattgttagaacacaacaataaaaaaatcttaatttaa

DBGET integrated database retrieval system