KEGG   Methanococcus aeolicus: Maeo_0476Help
Entry
Maeo_0476         CDS       T00552                                 

Definition
4Fe-4S ferredoxin
Orthology
K00204  
4Fe-4S ferredoxin
Organism
mae  Methanococcus aeolicus
Pathway
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Methanogenesis, CO2 => methane
Methanogen
Brite
KEGG Orthology (KO) [BR:mae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Maeo_0476
  Energy metabolism
   00680 Methane metabolism
    Maeo_0476
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(499393..499875)
Genome map
AA seq 160 aa AA seqDB search
MTQHILAGLRALTAKKLREKGLTHEEIAKLLNVDRTVITHYLAGRIPAKEAVKCAKVTAE
KFYPRDAVLFIKTVCDDNDIVTTITETLISDNIDVDVAISSKCNLCKICIDICPTKAITI
ENDLINIDKNKCCGCELCQELCQKNAIFLKIIKDNRGELD
NT seq 483 nt NT seq  +upstreamnt  +downstreamnt
atgactcaacatatattggcaggtttaagggcactcacggcaaaaaaacttcgggaaaaa
ggtttaacacatgaagagattgcaaaattacttaatgtagataggactgtaattacccat
tatttggctggacggatacctgcaaaagaagctgttaaatgtgcaaaagtcacggccgaa
aaattttatccgcgagatgctgttctttttattaaaaccgtatgtgatgacaatgacatt
gtaactacaattacggaaacattaatttctgataatattgatgttgatgtagccatttcc
agtaaatgtaatttatgtaaaatatgtattgacatatgtccaacaaaggcaataactatt
gaaaacgatctaatcaatattgataaaaataaatgttgtggatgtgagttatgtcaagaa
ttatgccaaaaaaatgcaatatttttaaaaataattaaggataatagaggagagttagat
taa

DBGET integrated database retrieval system