KEGG   Methanococcus aeolicus: Maeo_0541Help
Entry
Maeo_0541         CDS       T00552                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
mae  Methanococcus aeolicus
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:mae00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Maeo_0541
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Maeo_0541
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Maeo_0541
Enzymes [BR:mae01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Maeo_0541
Exosome [BR:mae04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Maeo_0541
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
554965..556485
Genome map
AA seq 506 aa AA seqDB search
MKKAIGILGVIFTIFILLASQASAAKSNAESASAFKSNGVKNVIILIGDGMGFSQLKLTK
QCYGHLSMEDIPSTGFELTDSLSGEVTDSAAAGTAIATGFKTYNGMISTIKKGEIKNVTT
LLELAELCNKSTGLVSTARITHATPAVFASHVEDRDMEKEISKQLIEHKVNVMFGGGKKE
FDSDTLNMAKNYGYNIVYDKKGLESANGNYILGLFSDSHIPYVLDRDENTPGLLDMTKKA
VDLLEKDNDGFFLMIEAGRIDHASHANDIASVVAETKEFDDVVNYCLDYARKNKDTLVIV
LADHETGGLAVGTGYGNPVNEEKILNIKASTDKMAKEIKSGKDPKEVLKEYAGITLTDDE
VKLINDARSSDNKYALGNTIAEIIDEKVGVGFVSHKHTGAPVPLMVYGKGSENFRGFLHH
VDTSKETAKLMLFGNTNKYIKNYGVSSLKGDANGDFVINKDDAYVTLMSYVGEEVDTQNE
EKLDMDNNGLIDYMDVAIIMNKAESY
NT seq 1521 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaaaagcaataggcatattaggtgtaatattcacaatattcatattgctggcatct
caggcgagtgcagcaaaaagtaatgcagaatcagcatcagcatttaagtcaaatggagtt
aaaaatgtaataatcttgataggggatggaatgggattcagtcagttgaaactaactaag
cagtgttatggtcatttaagtatggaagatattccatccacaggttttgagctcaccgac
tcattaagtggtgaggttacagattcagcagcagctggaacagcaattgccacaggattt
aaaacttacaatgggatgatttcaacaataaaaaaaggcgaaattaaaaatgtgacaaca
ttattggaattggcagaactatgcaataaatccacaggattggtatcaacagcaagaatt
acccatgcaactcctgcggtatttgcttcccatgttgaagatagggacatggaaaaagaa
atatctaaacagctaatagagcacaaagtaaatgtaatgtttggtggcggtaaaaaagaa
tttgacagcgataccttgaatatggcaaaaaattatggatataatattgtttatgataaa
aaaggattagaatcagcaaatggaaattatatattgggattgttctcagatagtcatata
ccttatgtattggatagagatgaaaatacaccaggattattagatatgactaaaaaagca
gtagatttattagaaaaagacaatgatggattctttttaatgatcgaagctggaagaatt
gaccatgcaagccatgccaatgatattgcgtcagtggtggctgaaacaaaagaatttgat
gatgttgtaaattactgcttagattatgcaaggaaaaacaaagatactttggttattgtt
cttgccgaccatgaaactggtggactggctgtggggacaggatacggtaatccagtgaat
gaagaaaaaatattaaacataaaagcaagcaccgacaaaatggcaaaagaaataaaaagc
ggaaaggacccgaaagaagttttaaaagaatacgcaggaataacattaaccgatgatgaa
gttaaattgataaatgatgctaggagctccgataacaagtatgcccttggaaataccata
gcagaaatcattgatgaaaaggttggagttggatttgtatcccacaaacacaccggagct
cctgtgccattaatggtgtatggaaaaggttctgagaattttaggggatttttacaccat
gtagatacaagtaaggagacggcaaaattgatgttgtttggaaataccaacaaatacata
aagaactacggcgtaagcagtttaaaaggagatgcaaatggtgattttgtaatcaacaaa
gatgacgcatacgttacattaatgtcctatgttggggaagaagttgatacacagaatgaa
gaaaaattagatatggataataatggattgattgattacatggatgttgccattataatg
aataaggcggaatcctactaa

DBGET integrated database retrieval system