KEGG   Methanococcus aeolicus: Maeo_0564Help
Entry
Maeo_0564         CDS       T00552                                 

Definition
alpha-L-glutamate ligase
Orthology
K15740  
tetrahydromethanopterin:alpha-L-glutamate ligase [EC:6.3.2.33]
Organism
mae  Methanococcus aeolicus
Pathway
Folate biosynthesis
Brite
KEGG Orthology (KO) [BR:mae00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Maeo_0564
Enzymes [BR:mae01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.33  tetrahydrosarcinapterin synthase
     Maeo_0564
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
581563..582444
Genome map
AA seq 293 aa AA seqDB search
MKIGIITEERDWITCSLERVLIKRDITPIYIKPSKIVSFTGMDIKFKCNNENLLKLNCAF
VRDLGDGTDYYRFDALKYLGEVMPLINPAEGLENAGNKYKTSMILDKNNIPHPKTIITED
LDKALMWSEKFKDCVVKPIFGNRGKGIIRLGNKPIINKINLLKEFKKKYGLFYIQEFIRN
PNNVYRDIRAFVIGDKVVSAMYRTSNNWLTNIHQQGTGKPCEITPEIEELAIKAKDSMGL
IYGGVDLMESKDGLKVIEVNGAPSWETLSKVSNVNVTEKLIDFVLNNVKDRYY
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgaaaataggaattattacagaagaaagggactggattacctgttcgttggaacgagtt
ttaattaaaagggatattactccgatatatataaaaccttccaaaatagtttcatttact
ggaatggacataaaatttaaatgtaataatgaaaatctattaaaattaaattgtgctttt
gttagggacctcggtgatgggactgattattatagatttgatgccctaaaatatttgggg
gaagttatgccgttgataaatccagcagaaggactggaaaatgcaggaaataaatataaa
acttcaatgattttggataaaaacaacataccacaccctaaaaccatcattacagaagat
ttagataaagcactaatgtggtcagaaaaatttaaagattgtgtcgtaaaaccaatattt
ggcaatagagggaaaggcattattagattgggaaataaaccaataattaataaaataaat
ctattaaaagaatttaagaaaaaatacggcttattttatattcaggaatttatacgaaat
ccaaataatgtatatagagatataagggcatttgttattggagataaggttgtttctgca
atgtataggacctcaaataattggctaaccaacatacaccagcagggaactggaaaacct
tgcgaaattacaccagaaatcgaagaattagcgattaaagcaaaagattctatggggctt
atatatggtggtgtggatttgatggaaagtaaagatgggctaaaagtaatagaagttaat
ggagctccctcatgggaaactctttcgaaagtttcaaatgtaaatgtcactgaaaaatta
atagatttcgtgttgaataatgttaaagatagatattattaa

DBGET integrated database retrieval system