KEGG   Methanococcus aeolicus: Maeo_0618Help
Entry
Maeo_0618         CDS       T00552                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
mae  Methanococcus aeolicus
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:mae00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Maeo_0618
Enzymes [BR:mae01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Maeo_0618
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(632724..634238)
Genome map
AA seq 504 aa AA seqDB search
MLFLEVKFLDLDLEANAVIINEEDIKGTAYYSQDRVLIESKTCSFIGTLQSTKTMIKPGE
VGVSKYIKDVKLNEGEEVRVRHAQKPQSVSYIRKKMNGQTLTADEIHTIIDEIVSKKLTN
VELSAFLVSTYIRGMNTEEIVAMTKRMAETGDTIQWEKRPVVDVHSIGGVPGNKYALLTI
PIVAAAGMTIPKTSSRAITSAAGTADVLEVITNVNLSCEEIQRVAKTTGGCLAWGGAVNL
APADDIIINVERPLSIDPQPQLLASVMAKKIATGIDYTVIDIPVGYGVKIKNEKEGNQLA
RKFIELGELLGIRVECVLTYGGQPIGRAIGPALEIKEALMALHDPKSAPNSLIEKSVSLA
GVLLELGGRAQIGQGQKVAWEILESGKALEKFNEIVVEQGGTITKPEEIELGEYTMDIRS
PKDGYVTGISNKLITKLAKEAGCPKDKKAGIFLGVKTGNKVNKEDILYTIYSSSEERLDA
AVNFARRTYPIKVEGMMLKRLSKF
NT seq 1515 nt NT seq  +upstreamnt  +downstreamnt
atgctatttttagaagttaaatttttagacttggatttagaggctaatgccgtgattata
aatgaggaggatataaaaggcacagcatattattcacaagacagagtattaatagaatcc
aaaacatgttcttttatcgggacacttcaatcaacaaaaacaatgattaaaccgggcgaa
gtaggagttagcaaatatattaaagatgtaaaattaaatgaaggtgaagaggttcgagta
agacatgctcaaaaaccacagtctgtctcatatatacgaaaaaaaatgaatggtcaaacc
ttaactgctgatgaaattcataccattattgatgaaatagtttcaaaaaaattaaccaat
gtcgaactttctgcatttttagtatccacatacataagaggaatgaatacggaggaaata
gtagcgatgacaaaaagaatggcggagacaggggacacaatacaatgggaaaaaagaccc
gttgtagatgtccatagtattgggggcgttccaggtaacaaatatgctcttttaactatt
cccatagtggcagcggccggaatgactattccaaaaacctcttctcgagcaattacctcc
gcagctggaacagctgatgttttagaagtaataacaaatgtaaatttaagctgtgaggaa
atacaaagagtggcaaaaacaacaggaggatgtttggcatggggcggagctgtaaattta
gcacctgctgacgatattattataaatgtggaaaggcccttatcaatagacccacaacct
caattattggcaagtgtaatggctaaaaagatagcaactggaattgattatacggtaata
gatatacctgttggatatggagttaaaataaaaaatgaaaaggaaggaaaccagttggca
agaaaatttatagagttgggggagctcctcggtattcgtgttgaatgtgttttaacctat
ggtggtcagccaataggtagggcaataggtccagctcttgaaataaaagaggctctaatg
gcattgcacgacccaaaatcagcaccaaatagtttaattgaaaaatcagtatctcttgca
ggagtattattggagctcgggggtagagcacaaattgggcaaggtcaaaaagtggcgtgg
gaaatattggaatctggaaaagcacttgaaaaattcaatgaaatagtggttgaacagggg
ggaacaataacaaagccggaggaaattgaattgggagaatatacaatggatattcgctca
ccaaaagatggatatgttacgggaatatcgaataaattaataacaaaattggcaaaagag
gcaggatgcccaaaggataaaaaagcaggaatttttttaggggtaaaaacaggaaataag
gtaaataaagaggatatattatataccatatattcaagttcagaggagcgattagatgca
gccgttaattttgcaagaagaacatatcccattaaagttgagggaatgatgcttaaaaga
ttgagtaaattttaa

DBGET integrated database retrieval system