KEGG   Methanococcus aeolicus: Maeo_0690Help
Entry
Maeo_0690         CDS       T00552                                 

Definition
aldolase (EC:4.1.2.13)
Orthology
K16305  
fructose-bisphosphate aldolase / 6-deoxy-5-ketofructose 1-phosphate synthase [EC:4.1.2.13 2.2.1.11]
Organism
mae  Methanococcus aeolicus
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:mae00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Maeo_0690
   01230 Biosynthesis of amino acids
    Maeo_0690
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Maeo_0690
   00030 Pentose phosphate pathway
    Maeo_0690
   00051 Fructose and mannose metabolism
    Maeo_0690
  Energy metabolism
   00680 Methane metabolism
    Maeo_0690
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Maeo_0690
Enzymes [BR:mae01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.11  6-deoxy-5-ketofructose 1-phosphate synthase
     Maeo_0690
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     Maeo_0690
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
708892..709806
Genome map
AA seq 304 aa AA seqDB search
MKTITREDVLVPAGVPENMKEEYISNYLNMTKNTGKLMLFAGDQKIEHLNDDFYGEGIPL
DDATPEHLFKIASKAKIGTFATQLGLIARYGKKYSDINYLVKMNSKTHLVKTNQRDPISK
ALVSIEDIVEFKKNSGLNIAGVGYTIYIGSEFESEMLVEASKIIYEAHKNGLVVVLWIYP
RGKAVKDEGDPHLIAGATGVGACLGADFVKVNYPKCENPAEVFKEAILAAGETKVICAGG
SSIDPKAFLQMLYDQIHISGAGGNATGRNIHQKTLKEAVNLCNAIYAITVEGKTVEEAWE
IYNK
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaccatcacaagagaagatgttttagttccagcaggagtccctgaaaatatgaaa
gaagaatatatatcaaattatcttaacatgacaaaaaacacaggaaaattaatgcttttt
gcaggagaccaaaagattgaacatttaaatgatgacttctatggagaaggaataccatta
gatgatgcaacaccagaacatttatttaaaattgcatcaaaagcaaaaataggaacattt
gcaacccaattaggattaattgcaagatatggtaaaaaatatagcgacataaattattta
gtaaaaatgaactcaaaaacccatcttgtaaaaacgaaccaaagagacccaattagtaaa
gctttggtatctattgaggacattgtagaatttaaaaagaattcgggattaaatatagct
ggtgtaggatatacaatatatattggtagtgaatttgaaagtgaaatgttggttgaagct
tcaaaaattatatatgaagcccataaaaatggattagttgtagtattatggatataccca
agaggtaaagctgttaaagatgagggagacccacatttaatagctggtgcaacaggagtt
ggtgcatgtttgggagctgactttgtaaaagtaaattatccaaaatgtgaaaacccagcc
gaggtatttaaagaggcaatattggcagcaggggaaacaaaagttatatgtgcgggaggg
agctccattgaccccaaggcatttttacagatgctttatgaccaaatacatataagtggt
gcaggtggaaatgccacaggaagaaatatacaccaaaaaacattaaaagaagctgtgaat
ttatgtaatgcaatatatgcaattacagtggaaggaaaaacagtagaggaagcatgggaa
atatataataaataa

DBGET integrated database retrieval system