KEGG   Methanococcus aeolicus: Maeo_0709Help
Entry
Maeo_0709         CDS       T00552                                 

Definition
(GenBank) Cellulase
Organism
mae  Methanococcus aeolicus
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(726186..727241)
Genome map
AA seq 351 aa AA seqDB search
MTVVNYLKELSTMEGISGREDRIRDYMEEELKKYCDEVFVDKFGNLIAKKGNTGKKIMIA
AHMDEIGLMVKYIDDKGFLKFVKIGGINDQMLLNQKVVVHTDKGDIIGVLGSKPPHKMKE
EERNKLMKSEFMFIDIGAKNKEDAINMGVEIGSWISFKTEFDVLGNNRITGKAFDDRAGC
AVLLDVAKKLKDMELNCQLYLVGTVQEEVGLKGAKTSAFGISPDVAFALDVTICGDHPGI
TMEDAAVEMGKGPVFGIVDAAGRGLIAHPKVITMVKEVSKKYDIPVQYEVGDGGTTDATS
IQLTQDGVPTGVISVPSRYIHTPVEMIDIEDLEKTSDLMLKCVVDLNNYFE
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
atgactgtggttaattatttaaaagaattatcgacgatggaaggaatatccggaagagaa
gatagaataagagattatatggaagaagaacttaaaaaatattgcgatgaagtattcgtt
gataaatttggaaatctcatagccaaaaaaggaaatactggaaaaaaaataatgattgca
gcacatatggacgagattggtttaatggttaaatatattgatgataaaggatttttaaaa
ttcgtaaaaattgggggaattaatgaccagatgcttttaaatcaaaaagtagttgttcat
acggataagggagatataattggtgttttaggttcaaaaccgccccacaaaatgaaagag
gaagaaagaaataaattaatgaaatcagaatttatgtttatagacattggggcaaaaaat
aaagaagatgccataaatatgggggttgaaataggctcatggatatcatttaaaactgaa
tttgatgttcttgggaacaatagaattacaggaaaagcctttgacgatagggcaggatgt
gctgttttgttggatgtggcaaaaaaattaaaagatatggaattaaattgtcaattatat
ttggttggaacagttcaggaggaagttgggttaaaaggtgctaaaacttcggcatttggt
ataagcccagatgttgcatttgcacttgatgtaacaatatgtggggaccacccaggtata
acaatggaggatgctgctgttgaaatgggaaaaggtccagtatttggaatagttgatgct
gctggaagaggtttaatagctcacccaaaagttataacgatggtaaaagaagtaagtaaa
aaatacgacattcctgttcaatatgaagttggagacggtggaactaccgatgccacttca
atacaattaactcaggatggagtgcctactggagttatttctgttccttctagatatatt
catacccccgttgagatgattgatattgaggatttggaaaaaacttcagatttaatgtta
aaatgtgtagttgatttaaataattattttgaataa

DBGET integrated database retrieval system