KEGG   Methanococcus aeolicus: Maeo_0836Help
Entry
Maeo_0836         CDS       T00552                                 

Definition
(GenBank) acetylornithine deacetylase or succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mae  Methanococcus aeolicus
Pathway
mae00300  Lysine biosynthesis
mae01100  Metabolic pathways
mae01120  Microbial metabolism in diverse environments
mae01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mae00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Maeo_0836
Enzymes [BR:mae01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Maeo_0836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Peptidase_M28
Motif
Other DBs
NCBI-ProteinID: ABR56418
JGI: Maeo0836
UniProt: A6UV96
Position
865233..866504
Genome map
AA seq 423 aa AA seqDB search
MNLMDETVEISSELIKINSVNPEFGGVGEEKKSKFVLDKLNEYIKKYNIKNYSIKQYNIK
DDKDIIRPNIVAKFDFGKEETLHIISHLDIVPEGDLNLWSNPPYKPVIKDGKIYGRGSED
NHKGIVSSLLLMNMIFQNSNFNNKKLFNPKYNLSLIFVSDEECGSKYGIQHILKRKQEIF
KKNDLFIVPDFGAPDGNLIEIAEKNILWIKFKIKGKQCHGSTPNNGVNADVLAFNFANNL
YNYLYSKYNKKDELFNPAYSTFEPTILSNNIENTNTIPGLVELNFDCRILPDYDINKVLK
DIDNFIDNFINKIPEYLIFYDKEELKNITIDYEILNKEQSQKTPKNSKLVLELKNAIKKV
LNKEPILCGMGGGTVGAFLRAEGYNTVVWGIGEETAHQPNEHIKLNDLIKMAKIYYEIME
GFK
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaacctaatggacgagacggtggaaatatcatcggaattaattaaaataaattcagta
aatccagaatttggcggagtaggggaagaaaaaaagtcaaaattcgtattggataaacta
aatgaatatataaaaaaatataatattaaaaattattcaataaaacaatataatataaag
gacgataaagacataatacgaccaaatattgtggcaaaatttgattttggaaaagaagag
acactccatataatttctcatttagatattgtgccagagggagatttaaatttatggagt
aatccaccatataagccagtaattaaagatgggaaaatttacggcaggggcagtgaggac
aaccataaaggaatagtttcttcattattattaatgaatatgatttttcaaaactccaat
ttcaacaacaaaaaattatttaatccaaaatataatttaagcctaatatttgtatctgat
gaagaatgtggaagcaaatacggaatacagcacatactaaaacgaaaacaagagatattt
aaaaaaaatgatttatttattgttccagatttcggagctcccgatggaaatcttatcgaa
attgcagaaaaaaatatattatggattaaatttaaaatcaaaggaaaacaatgtcatgga
agcaccccaaataatggggttaatgccgatgtattggcctttaattttgcaaataatctt
tataattatttatattcaaaatataataaaaaagacgaattatttaatcctgcctactct
acattcgaacctacaatattatcaaataacattgagaatacaaatacaattcctggattg
gtggaattaaattttgattgcagaatattgccagattacgatatcaacaaagtcttaaaa
gatatagataatttcatagataatttcataaataaaatccccgaatatttaatattttac
gataaagaggaattaaaaaatattaccattgattatgagatattaaataaagaacaatct
caaaaaactccaaaaaactccaaattagtattggaactgaaaaatgccattaaaaaagta
ttgaataaagaacccatattatgcggaatgggcggaggaactgttggggcatttttaagg
gcggaaggatacaatacagtagtttggggaattggagaagagacggcacatcagcccaat
gaacatataaaacttaatgatttaataaaaatggctaaaatatattatgaaattatggag
ggatttaaatga

DBGET integrated database retrieval system