KEGG   Methanococcus aeolicus: Maeo_0836Help
Entry
Maeo_0836         CDS       T00552                                 

Definition
diaminopimelate aminotransferase
Orthology
K01439  
succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
mae  Methanococcus aeolicus
Pathway
Lysine biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:mae00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Maeo_0836
  Amino acid metabolism
   00300 Lysine biosynthesis
    Maeo_0836
Enzymes [BR:mae01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     Maeo_0836
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
865233..866504
Genome map
AA seq 423 aa AA seqDB search
MNLMDETVEISSELIKINSVNPEFGGVGEEKKSKFVLDKLNEYIKKYNIKNYSIKQYNIK
DDKDIIRPNIVAKFDFGKEETLHIISHLDIVPEGDLNLWSNPPYKPVIKDGKIYGRGSED
NHKGIVSSLLLMNMIFQNSNFNNKKLFNPKYNLSLIFVSDEECGSKYGIQHILKRKQEIF
KKNDLFIVPDFGAPDGNLIEIAEKNILWIKFKIKGKQCHGSTPNNGVNADVLAFNFANNL
YNYLYSKYNKKDELFNPAYSTFEPTILSNNIENTNTIPGLVELNFDCRILPDYDINKVLK
DIDNFIDNFINKIPEYLIFYDKEELKNITIDYEILNKEQSQKTPKNSKLVLELKNAIKKV
LNKEPILCGMGGGTVGAFLRAEGYNTVVWGIGEETAHQPNEHIKLNDLIKMAKIYYEIME
GFK
NT seq 1272 nt NT seq  +upstreamnt  +downstreamnt
atgaacctaatggacgagacggtggaaatatcatcggaattaattaaaataaattcagta
aatccagaatttggcggagtaggggaagaaaaaaagtcaaaattcgtattggataaacta
aatgaatatataaaaaaatataatattaaaaattattcaataaaacaatataatataaag
gacgataaagacataatacgaccaaatattgtggcaaaatttgattttggaaaagaagag
acactccatataatttctcatttagatattgtgccagagggagatttaaatttatggagt
aatccaccatataagccagtaattaaagatgggaaaatttacggcaggggcagtgaggac
aaccataaaggaatagtttcttcattattattaatgaatatgatttttcaaaactccaat
ttcaacaacaaaaaattatttaatccaaaatataatttaagcctaatatttgtatctgat
gaagaatgtggaagcaaatacggaatacagcacatactaaaacgaaaacaagagatattt
aaaaaaaatgatttatttattgttccagatttcggagctcccgatggaaatcttatcgaa
attgcagaaaaaaatatattatggattaaatttaaaatcaaaggaaaacaatgtcatgga
agcaccccaaataatggggttaatgccgatgtattggcctttaattttgcaaataatctt
tataattatttatattcaaaatataataaaaaagacgaattatttaatcctgcctactct
acattcgaacctacaatattatcaaataacattgagaatacaaatacaattcctggattg
gtggaattaaattttgattgcagaatattgccagattacgatatcaacaaagtcttaaaa
gatatagataatttcatagataatttcataaataaaatccccgaatatttaatattttac
gataaagaggaattaaaaaatattaccattgattatgagatattaaataaagaacaatct
caaaaaactccaaaaaactccaaattagtattggaactgaaaaatgccattaaaaaagta
ttgaataaagaacccatattatgcggaatgggcggaggaactgttggggcatttttaagg
gcggaaggatacaatacagtagtttggggaattggagaagagacggcacatcagcccaat
gaacatataaaacttaatgatttaataaaaatggctaaaatatattatgaaattatggag
ggatttaaatga

DBGET integrated database retrieval system